BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0026 (686 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglu... 23 1.8 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 9.5 >EF592538-1|ABQ95984.1| 582|Tribolium castaneum beta-N-acetylglucosaminidase NAG3 protein. Length = 582 Score = 23.4 bits (48), Expect = 1.8 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -1 Query: 431 GGVCAPTTEWDARSDVRRATPFEEH 357 GGVC P T W D R P+ +H Sbjct: 478 GGVCDPYTPWHTFYDYR---PWVQH 499 Score = 21.0 bits (42), Expect = 9.5 Identities = 5/12 (41%), Positives = 7/12 (58%) Frame = +1 Query: 19 TWECQTDSCSSY 54 TW+C+ C Y Sbjct: 45 TWKCENQKCVKY 56 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.0 bits (42), Expect = 9.5 Identities = 13/48 (27%), Positives = 20/48 (41%) Frame = -2 Query: 166 NNNGESAEPCGTPAVS*RGRERVPSTRYRNERFDKKSRMMSTSLSGTP 23 ++NG E P+VS R P+ + + S+ SGTP Sbjct: 899 HSNGAKEEDEDKPSVSPLTSPRQPAETHAGSPCRNSASPASSDRSGTP 946 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,278 Number of Sequences: 336 Number of extensions: 3897 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18010165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -