BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0025 (644 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1223.06 |tea1|alp8|cell end marker Tea1|Schizosaccharomyces ... 30 0.33 SPCC550.03c |||RNA helicase involved in mRNA catabolism|Schizosa... 25 7.1 SPAC29B12.08 |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 25 9.3 >SPCC1223.06 |tea1|alp8|cell end marker Tea1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1147 Score = 29.9 bits (64), Expect = 0.33 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 5/65 (7%) Frame = +2 Query: 413 MIPSSRF*-YRTARHRSRVHPYYLEPLRSSTMRF----QRYFLPGTIRLWNELPPPVFPE 577 ++ SSR Y ++ RS HP + + SS RF Q P + R N+LP PV P Sbjct: 413 LLTSSRIPSYNGSKVRSTSHPSRQQYIGSSNSRFNTRHQTISTPVSGRASNDLPSPVVPT 472 Query: 578 RYDMS 592 R + S Sbjct: 473 RSNSS 477 >SPCC550.03c |||RNA helicase involved in mRNA catabolism|Schizosaccharomyces pombe|chr 3|||Manual Length = 1213 Score = 25.4 bits (53), Expect = 7.1 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 476 YLEPLRSSTMRFQRYFLPGTIRLWNELP 559 Y E L + +RFQR+ L G I + E+P Sbjct: 77 YPETLARTQIRFQRHGLEGKIMGYKEVP 104 >SPAC29B12.08 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 682 Score = 25.0 bits (52), Expect = 9.3 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = -1 Query: 215 PAHHTNVYPMRGIEPTTL 162 P HH+++ P G++P+T+ Sbjct: 184 PPHHSSLPPHMGVDPSTM 201 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,620,061 Number of Sequences: 5004 Number of extensions: 52679 Number of successful extensions: 105 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 105 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 289756512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -