BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0025 (644 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0875 + 21212413-21212758,21215931-21217357 28 5.5 07_03_1752 - 29218348-29218524,29218593-29218736,29218957-292191... 28 7.3 04_04_0092 - 22759791-22760676,22761446-22761813,22762202-227622... 28 7.3 04_04_0089 - 22724971-22725035,22725403-22725466,22725602-227256... 28 7.3 04_03_0708 + 18888085-18889337,18889583-18889661,18890458-18890781 28 7.3 11_06_0768 + 27129007-27129038,27129140-27129220,27129723-271300... 27 9.7 >10_08_0875 + 21212413-21212758,21215931-21217357 Length = 590 Score = 28.3 bits (60), Expect = 5.5 Identities = 13/29 (44%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Frame = +3 Query: 537 SGFGMSSPHRCFPSAMTCPS--SNETCVE 617 +GFG S RC+ SA C + S++ CVE Sbjct: 79 AGFGNRSQDRCYASAENCSTAVSSQLCVE 107 >07_03_1752 - 29218348-29218524,29218593-29218736,29218957-29219148, 29219225-29219440,29219873-29220010,29220137-29220232, 29221204-29221357,29221976-29222098,29222291-29222418, 29222669-29222773,29223396-29223437,29223631-29223746, 29223805-29223916 Length = 580 Score = 27.9 bits (59), Expect = 7.3 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = -3 Query: 216 TCSSHECLPDEGNRTHDPRRNSRGR*LLHHRVSQQYKHFQIM-FILRTRYLKIDNFNLLT 40 TC L DEG + P S GR +LH + ++ ++ I+ Y + FN + Sbjct: 189 TCEKITWLLDEGEKWLKPEYRSCGRSMLHKKAKVEFYPLGVIGAIVSWNYPFHNVFNPML 248 Query: 39 ASSNNANFAV 10 A+ + N AV Sbjct: 249 AAIFSGNAAV 258 >04_04_0092 - 22759791-22760676,22761446-22761813,22762202-22762207, 22763365-22763603,22764808-22765339 Length = 676 Score = 27.9 bits (59), Expect = 7.3 Identities = 17/32 (53%), Positives = 21/32 (65%) Frame = +1 Query: 331 ILLWGRITVRNLFQVILNFIVT*GVVRDDSII 426 I L+G I VR+L +LN+IV G RDD II Sbjct: 225 IELYGYIAVRDLQDPLLNYIVKIG--RDDPII 254 >04_04_0089 - 22724971-22725035,22725403-22725466,22725602-22725688, 22726775-22726789,22736269-22736685,22738235-22738473, 22739673-22740223,22740440-22740540 Length = 512 Score = 27.9 bits (59), Expect = 7.3 Identities = 17/32 (53%), Positives = 21/32 (65%) Frame = +1 Query: 331 ILLWGRITVRNLFQVILNFIVT*GVVRDDSII 426 I L+G I VR+L +LN+IV G RDD II Sbjct: 265 IELYGYIAVRDLQDPLLNYIVKIG--RDDPII 294 >04_03_0708 + 18888085-18889337,18889583-18889661,18890458-18890781 Length = 551 Score = 27.9 bits (59), Expect = 7.3 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 497 STMRFQRYFLPGTIRLWNELPPPVFP 574 +T+R QR +L T+ W+ LP P +P Sbjct: 521 TTLRPQRMWLASTVSGWDGLPRPTWP 546 >11_06_0768 + 27129007-27129038,27129140-27129220,27129723-27130089, 27130165-27130255,27130515-27130595,27130764-27131830, 27132060-27132071,27132465-27133209,27133210-27135244, 27135712-27135787,27135925-27136029,27137080-27137166 Length = 1592 Score = 27.5 bits (58), Expect = 9.7 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -2 Query: 619 YSTQVSFEEGHVIALGKHRWGELIPKP 539 + QV FE+GH++ W +P P Sbjct: 1158 FKEQVKFEDGHLLIWNPREWEYQLPSP 1184 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,001,014 Number of Sequences: 37544 Number of extensions: 382740 Number of successful extensions: 815 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 802 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 815 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1596695220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -