BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0025 (644 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L36529-1|AAA53571.1| 657|Homo sapiens protein p84 protein. 32 1.5 BC010381-1|AAH10381.1| 657|Homo sapiens THO complex 1 protein. 32 2.0 >L36529-1|AAA53571.1| 657|Homo sapiens protein p84 protein. Length = 657 Score = 32.3 bits (70), Expect = 1.5 Identities = 15/56 (26%), Positives = 27/56 (48%) Frame = +2 Query: 398 EELFEMIPSSRF*YRTARHRSRVHPYYLEPLRSSTMRFQRYFLPGTIRLWNELPPP 565 E ++ + +S + +R + +R P++ +P Q Y I+L ELPPP Sbjct: 481 ENEYKAMNNSNYGWRALKLLARRSPHFFQPTNQQFKSLQEYLENMVIKLAKELPPP 536 >BC010381-1|AAH10381.1| 657|Homo sapiens THO complex 1 protein. Length = 657 Score = 31.9 bits (69), Expect = 2.0 Identities = 15/56 (26%), Positives = 26/56 (46%) Frame = +2 Query: 398 EELFEMIPSSRF*YRTARHRSRVHPYYLEPLRSSTMRFQRYFLPGTIRLWNELPPP 565 E ++ + +S + +R R +R P++ +P Y I+L ELPPP Sbjct: 481 ENEYKAVNNSNYGWRALRLLARRSPHFFQPTNQQFKSLPEYLENMVIKLAKELPPP 536 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,157,281 Number of Sequences: 237096 Number of extensions: 2018304 Number of successful extensions: 3715 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3647 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3715 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7141427170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -