BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0024 (455 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5KCB8 Cluster: Expressed protein; n=2; Filobasidiella ... 33 3.8 UniRef50_Q969R2 Cluster: Oxysterol-binding protein 2; n=76; Eume... 32 5.1 >UniRef50_Q5KCB8 Cluster: Expressed protein; n=2; Filobasidiella neoformans|Rep: Expressed protein - Cryptococcus neoformans (Filobasidiella neoformans) Length = 864 Score = 32.7 bits (71), Expect = 3.8 Identities = 19/43 (44%), Positives = 24/43 (55%) Frame = -3 Query: 351 PPRNMRSKFQLYSITAVRPLKLECIAASRQI*W*WCTRAG*QD 223 PP+ R + QLYS R LKL+C RQ+ CTR G Q+ Sbjct: 29 PPKKKRRQRQLYSCAECRRLKLKC---DRQVPCSNCTRRGCQE 68 >UniRef50_Q969R2 Cluster: Oxysterol-binding protein 2; n=76; Eumetazoa|Rep: Oxysterol-binding protein 2 - Homo sapiens (Human) Length = 916 Score = 32.3 bits (70), Expect = 5.1 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 6/58 (10%) Frame = +2 Query: 212 CDRVSCQPARVHHYHY------IWREAAIHSSFKGRTAVILYS*NLDLMFRGG*RHYV 367 C++VS P HY + +W+E I S F+G+ I+ + L F+ HYV Sbjct: 621 CEQVSHHPPSAAHYVFSKHGWSLWQEITISSKFRGKYISIMPLGAIHLEFQASGNHYV 678 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 483,134,353 Number of Sequences: 1657284 Number of extensions: 9725845 Number of successful extensions: 18038 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18038 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 23931581955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -