BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0017 (672 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q2F5N9 Cluster: Nucleoplasmin isoform 2; n=7; Endoptery... 45 0.001 UniRef50_Q27395 Cluster: Protein lin-15B; n=2; Caenorhabditis el... 36 1.2 >UniRef50_Q2F5N9 Cluster: Nucleoplasmin isoform 2; n=7; Endopterygota|Rep: Nucleoplasmin isoform 2 - Bombyx mori (Silk moth) Length = 187 Score = 45.2 bits (102), Expect = 0.001 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 16/43 (37%) Frame = -1 Query: 672 EEEGDDSQFK----------------DEDNEEGEPKGKKAKMS 592 EEEGDDSQFK DEDNEEGEPKGKKAKMS Sbjct: 129 EEEGDDSQFKEDENKRKGAGKRKPNEDEDNEEGEPKGKKAKMS 171 >UniRef50_Q27395 Cluster: Protein lin-15B; n=2; Caenorhabditis elegans|Rep: Protein lin-15B - Caenorhabditis elegans Length = 1440 Score = 35.5 bits (78), Expect = 1.2 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +3 Query: 549 WHSSWA-MQLCLWHYSTFSLFCPWVHLLHYLHP*TENHLLLL 671 WHS+ + CL + TF+ FC + +LHY+ T NHL+ L Sbjct: 291 WHSTAIFLTRCLVWHDTFTEFCGKLDILHYIDNETFNHLIYL 332 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 576,856,858 Number of Sequences: 1657284 Number of extensions: 10522129 Number of successful extensions: 31009 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25733 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30529 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 51652897375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -