Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ceN-0017
         (672 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q2F5N9 Cluster: Nucleoplasmin isoform 2; n=7; Endoptery...    45   0.001
UniRef50_Q27395 Cluster: Protein lin-15B; n=2; Caenorhabditis el...    36   1.2  

>UniRef50_Q2F5N9 Cluster: Nucleoplasmin isoform 2; n=7;
           Endopterygota|Rep: Nucleoplasmin isoform 2 - Bombyx mori
           (Silk moth)
          Length = 187

 Score = 45.2 bits (102), Expect = 0.001
 Identities = 27/43 (62%), Positives = 27/43 (62%), Gaps = 16/43 (37%)
 Frame = -1

Query: 672 EEEGDDSQFK----------------DEDNEEGEPKGKKAKMS 592
           EEEGDDSQFK                DEDNEEGEPKGKKAKMS
Sbjct: 129 EEEGDDSQFKEDENKRKGAGKRKPNEDEDNEEGEPKGKKAKMS 171


>UniRef50_Q27395 Cluster: Protein lin-15B; n=2; Caenorhabditis
           elegans|Rep: Protein lin-15B - Caenorhabditis elegans
          Length = 1440

 Score = 35.5 bits (78), Expect = 1.2
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%)
 Frame = +3

Query: 549 WHSSWA-MQLCLWHYSTFSLFCPWVHLLHYLHP*TENHLLLL 671
           WHS+   +  CL  + TF+ FC  + +LHY+   T NHL+ L
Sbjct: 291 WHSTAIFLTRCLVWHDTFTEFCGKLDILHYIDNETFNHLIYL 332


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 576,856,858
Number of Sequences: 1657284
Number of extensions: 10522129
Number of successful extensions: 31009
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 25733
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 30529
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 51652897375
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)