BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0013 (384 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.3 SB_40766| Best HMM Match : WD40 (HMM E-Value=1.19993e-41) 27 5.2 >SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1086 Score = 28.3 bits (60), Expect = 2.3 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 31 IMILCCEVVFQSVLMDETTFI*WNR 105 + +L CE V Q V+ D+T F+ WNR Sbjct: 181 LRVLLCEPVKQGVIDDDTIFV-WNR 204 >SB_40766| Best HMM Match : WD40 (HMM E-Value=1.19993e-41) Length = 1487 Score = 27.1 bits (57), Expect = 5.2 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Frame = -2 Query: 161 WNTVSLFTYS*FYQNRKEIR---FHYIKVVSSIKTD*KTTSQHKIMMVITVRGLKM 3 W TV+L T + FY+ R++ R H++ V + TD + +MM+I + L+M Sbjct: 1041 WKTVALSTLNPFYRQRRDFRKEKQHFLHVTDHV-TD-HVCYRIVMMMIIDLMLLRM 1094 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,743,973 Number of Sequences: 59808 Number of extensions: 193710 Number of successful extensions: 345 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 330 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 345 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 656970245 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -