BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0013 (384 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 25 1.3 AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylch... 22 6.7 AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylch... 22 6.7 AY146752-1|AAO12067.1| 277|Anopheles gambiae odorant-binding pr... 22 6.7 AY146751-1|AAO12066.1| 277|Anopheles gambiae odorant-binding pr... 22 6.7 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 24.6 bits (51), Expect = 1.3 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = -3 Query: 307 HGLNLREFASPSKTSVSQNLPPDRNLDSLRRSGEKI 200 HG N R ++PS+ + R ++ LRR+ ++ Sbjct: 1161 HGRNRRSRSAPSEADTIRRRMRRREMERLRRTARRV 1196 >AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 7 protein. Length = 509 Score = 22.2 bits (45), Expect = 6.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +3 Query: 156 VPKKKNQIHDN*CP 197 VP K+N+I+ N CP Sbjct: 185 VPGKRNEIYYNCCP 198 >AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 5 protein. Length = 533 Score = 22.2 bits (45), Expect = 6.7 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +3 Query: 156 VPKKKNQIHDN*CP 197 VP K+N+I+ N CP Sbjct: 217 VPGKRNEIYYNCCP 230 >AY146752-1|AAO12067.1| 277|Anopheles gambiae odorant-binding protein AgamOBP35 protein. Length = 277 Score = 22.2 bits (45), Expect = 6.7 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -1 Query: 78 IHQNRLKDYFAAQNHDGDN 22 +H+N L +YF D DN Sbjct: 85 LHENVLANYFVPATEDCDN 103 >AY146751-1|AAO12066.1| 277|Anopheles gambiae odorant-binding protein AgamOBP36 protein. Length = 277 Score = 22.2 bits (45), Expect = 6.7 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -1 Query: 78 IHQNRLKDYFAAQNHDGDN 22 +H+N L +YF D DN Sbjct: 85 LHENVLANYFVPATEDCDN 103 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 366,676 Number of Sequences: 2352 Number of extensions: 6812 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 29501847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -