BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0010 (677 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 23 3.0 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 21 9.3 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 22.6 bits (46), Expect = 3.0 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -1 Query: 386 IFVNFSSYEHHWLKARNTQMIFARL 312 IF+N EH+ ++ +N + F R+ Sbjct: 130 IFINLPFLEHNLIRLKNCVIYFNRI 154 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 21.0 bits (42), Expect = 9.3 Identities = 9/35 (25%), Positives = 18/35 (51%) Frame = +3 Query: 225 LSLQACPAVLFNT*IDKYYYSLGLSFLILKSCENH 329 L + AC AV+ T K + + + ++ C++H Sbjct: 220 LIISACYAVIVRTIWSKSKLLIPVGHIPIRQCDDH 254 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,438 Number of Sequences: 336 Number of extensions: 3189 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17697850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -