BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0006 (465 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT024449-1|ABC86511.1| 1403|Drosophila melanogaster GH15984p pro... 27 9.4 AY118968-1|AAM50828.1| 531|Drosophila melanogaster LD45876p pro... 27 9.4 AL031884-3|CAA21413.1| 658|Drosophila melanogaster EG:23E12.2 p... 27 9.4 >BT024449-1|ABC86511.1| 1403|Drosophila melanogaster GH15984p protein. Length = 1403 Score = 27.5 bits (58), Expect = 9.4 Identities = 18/76 (23%), Positives = 43/76 (56%), Gaps = 3/76 (3%) Frame = +3 Query: 120 LNDPILLIKRKNYLRDNSVIFFFSSNKKKSLRPRCWIKIKFKCRSLKF*SVRSLK--SYM 293 L P L+++ N + ++ FF SS+ +++ + +K KC ++ SL+ +++ Sbjct: 990 LATPNLVLRLGNKANNKTITFFLSSDFERTQWIDSILSLKQKCNLPGANTINSLEVTAFI 1049 Query: 294 I*VQTGV-SQVGFYLL 338 + +Q G+ +++G YL+ Sbjct: 1050 VAMQKGMKTEMGSYLM 1065 >AY118968-1|AAM50828.1| 531|Drosophila melanogaster LD45876p protein. Length = 531 Score = 27.5 bits (58), Expect = 9.4 Identities = 18/76 (23%), Positives = 43/76 (56%), Gaps = 3/76 (3%) Frame = +3 Query: 120 LNDPILLIKRKNYLRDNSVIFFFSSNKKKSLRPRCWIKIKFKCRSLKF*SVRSLK--SYM 293 L P L+++ N + ++ FF SS+ +++ + +K KC ++ SL+ +++ Sbjct: 118 LATPNLVLRLGNKANNKTITFFLSSDFERTQWIDSILSLKQKCNLPGANTINSLEVTAFI 177 Query: 294 I*VQTGV-SQVGFYLL 338 + +Q G+ +++G YL+ Sbjct: 178 VAMQKGMKTEMGSYLM 193 >AL031884-3|CAA21413.1| 658|Drosophila melanogaster EG:23E12.2 protein. Length = 658 Score = 27.5 bits (58), Expect = 9.4 Identities = 18/76 (23%), Positives = 43/76 (56%), Gaps = 3/76 (3%) Frame = +3 Query: 120 LNDPILLIKRKNYLRDNSVIFFFSSNKKKSLRPRCWIKIKFKCRSLKF*SVRSLK--SYM 293 L P L+++ N + ++ FF SS+ +++ + +K KC ++ SL+ +++ Sbjct: 298 LATPNLVLRLGNKANNKTITFFLSSDFERTQWIDSILSLKQKCNLPGANTINSLEVTAFI 357 Query: 294 I*VQTGV-SQVGFYLL 338 + +Q G+ +++G YL+ Sbjct: 358 VAMQKGMKTEMGSYLM 373 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,313,948 Number of Sequences: 53049 Number of extensions: 191595 Number of successful extensions: 241 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 241 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 241 length of database: 24,988,368 effective HSP length: 79 effective length of database: 20,797,497 effective search space used: 1559812275 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -