BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0005 (675 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y17702-1|CAA76822.2| 260|Anopheles gambiae putative gVAG protei... 29 0.18 AF457548-1|AAL68778.1| 178|Anopheles gambiae antigen 5-related ... 27 0.72 X93562-1|CAA63775.1| 131|Anopheles gambiae defensin protein. 26 1.3 DQ212041-1|ABB00986.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212040-1|ABB00985.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212039-1|ABB00984.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212038-1|ABB00983.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212037-1|ABB00982.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212036-1|ABB00981.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212035-1|ABB00980.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212034-1|ABB00979.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212033-1|ABB00978.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212032-1|ABB00977.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212031-1|ABB00976.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212030-1|ABB00975.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212029-1|ABB00974.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212028-1|ABB00973.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212027-1|ABB00972.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212026-1|ABB00971.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212025-1|ABB00970.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212024-1|ABB00969.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212023-1|ABB00968.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212022-1|ABB00967.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212021-1|ABB00966.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212020-1|ABB00965.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212019-1|ABB00964.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212018-1|ABB00963.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212017-1|ABB00962.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212016-1|ABB00961.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212015-1|ABB00960.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212014-1|ABB00959.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212013-1|ABB00958.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212012-1|ABB00957.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212011-1|ABB00956.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212010-1|ABB00955.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212009-1|ABB00954.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212008-1|ABB00953.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212007-1|ABB00952.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212006-1|ABB00951.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212005-1|ABB00950.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212004-1|ABB00949.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212003-1|ABB00948.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212002-1|ABB00947.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212001-1|ABB00946.1| 102|Anopheles gambiae defensin protein. 26 1.3 DQ212042-1|ABB00987.1| 102|Anopheles gambiae defensin protein. 25 1.7 AF063402-1|AAC18575.1| 102|Anopheles gambiae defensin protein. 25 2.2 AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 24 5.0 EF382662-1|ABN54495.1| 178|Anopheles gambiae CPF family cuticle... 23 6.7 >Y17702-1|CAA76822.2| 260|Anopheles gambiae putative gVAG protein precursor protein. Length = 260 Score = 28.7 bits (61), Expect = 0.18 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = -2 Query: 551 LLDQMSCDGK*CSR--CDRHGLHEGCRVGSGSKRATC 447 +L +S GK CS C R G H GC S S TC Sbjct: 14 VLSGVSAGGKYCSSDLCPRGGPHVGCNPPSSSGGPTC 50 >AF457548-1|AAL68778.1| 178|Anopheles gambiae antigen 5-related 1 protein protein. Length = 178 Score = 26.6 bits (56), Expect = 0.72 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = -2 Query: 551 LLDQMSCDGK*CSR--CDRHGLHEGCRVGSGSKRATC 447 +L +S G+ CS C R G H GC S S TC Sbjct: 14 VLSVVSVGGQYCSSDLCPRGGPHVGCNPPSSSGGPTC 50 >X93562-1|CAA63775.1| 131|Anopheles gambiae defensin protein. Length = 131 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 89 AKRATCDLASGFGVGSSLCAAH 110 >DQ212041-1|ABB00986.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212040-1|ABB00985.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212039-1|ABB00984.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212038-1|ABB00983.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212037-1|ABB00982.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212036-1|ABB00981.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212035-1|ABB00980.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212034-1|ABB00979.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212033-1|ABB00978.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212032-1|ABB00977.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212031-1|ABB00976.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212030-1|ABB00975.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212029-1|ABB00974.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212028-1|ABB00973.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212027-1|ABB00972.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212026-1|ABB00971.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212025-1|ABB00970.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212024-1|ABB00969.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212023-1|ABB00968.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212022-1|ABB00967.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212021-1|ABB00966.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212020-1|ABB00965.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212019-1|ABB00964.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212018-1|ABB00963.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212017-1|ABB00962.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212016-1|ABB00961.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212015-1|ABB00960.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212014-1|ABB00959.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212013-1|ABB00958.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212012-1|ABB00957.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212011-1|ABB00956.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212010-1|ABB00955.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212009-1|ABB00954.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212008-1|ABB00953.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212007-1|ABB00952.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212006-1|ABB00951.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212005-1|ABB00950.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212004-1|ABB00949.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212003-1|ABB00948.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212002-1|ABB00947.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212001-1|ABB00946.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.8 bits (54), Expect = 1.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLASGFGVGSSLCAAH 81 >DQ212042-1|ABB00987.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.4 bits (53), Expect = 1.7 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG+ AH Sbjct: 60 AKRATCDLARGFGVGSSLCAAH 81 >AF063402-1|AAC18575.1| 102|Anopheles gambiae defensin protein. Length = 102 Score = 25.0 bits (52), Expect = 2.2 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -2 Query: 464 SKRATCDVGVGSDVGARSDVAH 399 +KRATCD+ G VG AH Sbjct: 60 AKRATCDLASGFGVGNNLCAAH 81 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 23.8 bits (49), Expect = 5.0 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +2 Query: 530 RSSSDQEEVCPRAGDNLHR 586 RSS+D++++C R G H+ Sbjct: 491 RSSTDRQQLCIRCGSEGHK 509 >EF382662-1|ABN54495.1| 178|Anopheles gambiae CPF family cuticle protein protein. Length = 178 Score = 23.4 bits (48), Expect = 6.7 Identities = 17/64 (26%), Positives = 28/64 (43%), Gaps = 3/64 (4%) Frame = +3 Query: 309 STSYVSSIPLISQPIAYSAHFIKKRSPQWPVSYIAPSSYITPNTYIASGPL---GATTYT 479 S+ V S L + AY+A +K +P + Y AP+ + + A+ + A Y Sbjct: 64 SSVRVHSSRLSNDGYAYAAPAVKYAAPAYAAHYAAPAVHYPAAAHYAAPAVHYPAAAHYA 123 Query: 480 TPFV 491 P V Sbjct: 124 APAV 127 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 639,795 Number of Sequences: 2352 Number of extensions: 12207 Number of successful extensions: 68 Number of sequences better than 10.0: 48 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -