BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0004 (688 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC162.04c |wtf13||wtf element Wtf13|Schizosaccharomyces pombe|... 27 2.5 SPCC285.07c |wtf18||wtf element Wtf18|Schizosaccharomyces pombe|... 27 2.5 >SPCC162.04c |wtf13||wtf element Wtf13|Schizosaccharomyces pombe|chr 3|||Manual Length = 418 Score = 27.1 bits (57), Expect = 2.5 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = -2 Query: 633 IKNLSIHINKIGV-SVCNIEIAAFYYMHMNICTVHTLK*HFFTIFVCLSVCS 481 +K+ +++NK + S C+I A F+ + + + TLK F +F L V S Sbjct: 227 VKDGRLNLNKALICSTCSISAALFFILLLVCIPIWTLKHMLFGLFQVLGVQS 278 >SPCC285.07c |wtf18||wtf element Wtf18|Schizosaccharomyces pombe|chr 3|||Manual Length = 402 Score = 27.1 bits (57), Expect = 2.5 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = -2 Query: 633 IKNLSIHINKIGV-SVCNIEIAAFYYMHMNICTVHTLK*HFFTIFVCLSVCS 481 +K+ +++NK + S C+I A F+ + + + TLK F +F L V S Sbjct: 217 VKDGRLNLNKALICSTCSISAALFFILLLVCIPIWTLKHMLFGLFQVLGVQS 268 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,417,027 Number of Sequences: 5004 Number of extensions: 47243 Number of successful extensions: 103 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 103 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -