BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0004 (688 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33785| Best HMM Match : DUF23 (HMM E-Value=8.2e-36) 28 6.2 SB_57595| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 >SB_33785| Best HMM Match : DUF23 (HMM E-Value=8.2e-36) Length = 338 Score = 28.3 bits (60), Expect = 6.2 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 2/51 (3%) Frame = +2 Query: 137 LLRLI*HNYFFYFNRQKIPEVNFLILYYWSSKDYVADV--WNINYIIY*RP 283 L +L+ N+F +++ + PEVN ++ YY ++ VA+V WN+ + RP Sbjct: 109 LTKLLGANHFTFYDFKTDPEVNNVLRYYQETQ--VANVLPWNLPSNLVSRP 157 >SB_57595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 310 Score = 27.9 bits (59), Expect = 8.1 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 236 YVADVWNINYIIY*RPALASLRKH 307 Y+ D+W + Y+IY P A LR+H Sbjct: 144 YLKDLWPMLYLIYTTPLGAILRRH 167 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,897,510 Number of Sequences: 59808 Number of extensions: 320580 Number of successful extensions: 650 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 549 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 649 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -