BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0001 (642 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 25 0.70 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 23 1.6 AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 23 1.6 AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 23 1.6 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 23 1.6 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 23 1.6 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 23 1.6 AF260821-1|AAG02019.1| 134|Tribolium castaneum alpha-esterase l... 23 1.6 AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve co... 21 6.5 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 8.6 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 21 8.6 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 24.6 bits (51), Expect = 0.70 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -1 Query: 603 VLRLPVEGRSFERDAAISHDVFRPMSGG 520 ++ +P GRSFE D+ P SGG Sbjct: 757 MIGMPTYGRSFELVNKTQFDIGAPASGG 784 Score = 22.2 bits (45), Expect = 3.7 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = -1 Query: 603 VLRLPVEGRSFERDAAISHDVFRPMSGG 520 V+ +P GR+F V P SGG Sbjct: 328 VIGMPTYGRTFTLSNTAKFGVHAPASGG 355 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 23.4 bits (48), Expect = 1.6 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 505 TGSQRTARHGTEHVMTNGCI 564 TGS T HG E++MT + Sbjct: 109 TGSSETDLHGPEYLMTEDVV 128 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 23.4 bits (48), Expect = 1.6 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 505 TGSQRTARHGTEHVMTNGCI 564 TGS T HG E++MT + Sbjct: 111 TGSSETDLHGPEYLMTEDVV 130 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 23.4 bits (48), Expect = 1.6 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 505 TGSQRTARHGTEHVMTNGCI 564 TGS T HG E++MT + Sbjct: 109 TGSSETDLHGPEYLMTEDVV 128 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 23.4 bits (48), Expect = 1.6 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 505 TGSQRTARHGTEHVMTNGCI 564 TGS T HG E++MT + Sbjct: 111 TGSSETDLHGPEYLMTEDVV 130 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 23.4 bits (48), Expect = 1.6 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = -1 Query: 483 RVHAVISMLGRSIDGQSPHVVKSRIKWQTGAHPQK-HVCAEVITRCPEVIF 334 RV VIS L S +P + RIK +G ++ AEV+T P+++F Sbjct: 193 RVEEVISDLALSKCQNTPIGILGRIKGISGGEKKRLSFAAEVLTN-PKLMF 242 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 23.4 bits (48), Expect = 1.6 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = -1 Query: 483 RVHAVISMLGRSIDGQSPHVVKSRIKWQTGAHPQK-HVCAEVITRCPEVIF 334 RV VIS L S +P + RIK +G ++ AEV+T P+++F Sbjct: 193 RVEEVISDLALSKCQNTPIGILGRIKGISGGEKKRLSFAAEVLTN-PKLMF 242 >AF260821-1|AAG02019.1| 134|Tribolium castaneum alpha-esterase like protein E2 protein. Length = 134 Score = 23.4 bits (48), Expect = 1.6 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 505 TGSQRTARHGTEHVMTNGCI 564 TGS T HG E++MT + Sbjct: 83 TGSSETDLHGPEYLMTEDVV 102 >AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve cord defective protein protein. Length = 168 Score = 21.4 bits (43), Expect = 6.5 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +3 Query: 492 TTRKHWFTTHRPTWDGTRHD*WLHRAQSSD 581 T K WF HR +H+ +H Q+++ Sbjct: 82 TQVKIWFQNHRYKTKRAQHEKGMHDQQNNN 111 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 8.6 Identities = 12/44 (27%), Positives = 17/44 (38%) Frame = -1 Query: 462 MLGRSIDGQSPHVVKSRIKWQTGAHPQKHVCAEVITRCPEVIFV 331 +LGR D P + G PQ+ V + C +FV Sbjct: 2200 ILGRDNDKTKPKPTTMKPTTTIGYEPQEPVLPAEVVPCQGRLFV 2243 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 21.0 bits (42), Expect = 8.6 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 Query: 385 WMSTGLPFNATFNYMRRLPIDAPAQH 462 W+ TGL +A + R I PA H Sbjct: 110 WLGTGLLTSAGPKWQNRRKILTPAFH 135 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,967 Number of Sequences: 336 Number of extensions: 3233 Number of successful extensions: 16 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16448590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -