BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ceN-0001 (642 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC16C9.04c |||CCR4-Not complex subunit Mot2 |Schizosaccharomyc... 27 1.7 SPAC1687.09 |||conserved fungal protein|Schizosaccharomyces pomb... 27 3.0 SPAC30D11.09 |cwf19||complexed with Cdc5 protein Cwf19 |Schizosa... 26 4.0 SPAC3F10.06c |||initiator methionine tRNA 2'-O-ribosyl phosphate... 25 7.0 SPBP22H7.09c |mis15||kinetochore protein Mis15 |Schizosaccharomy... 25 9.3 SPAC19A8.04 |erg5||C-22 sterol desaturase Erg5 |Schizosaccharomy... 25 9.3 >SPAC16C9.04c |||CCR4-Not complex subunit Mot2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 489 Score = 27.5 bits (58), Expect = 1.7 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = -2 Query: 467 SACWAGASMGSLRM*LKVALNGRPVLIHKNMSVPRLLPDVQK 342 +A WA S L+ L+ A+N +P+ K+ S +P +QK Sbjct: 349 TAAWAKLSPSVLQERLRAAVNQQPLDALKSSSTQTSIPKIQK 390 >SPAC1687.09 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1379 Score = 26.6 bits (56), Expect = 3.0 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +1 Query: 445 DAPAQHAD--DSMDPLDVPQGSTGSQRTARHGTEHVMTNGCI 564 DAP+ D S PLDVP G+ S +G+++ ++G + Sbjct: 1047 DAPSDKEDLGSSNAPLDVPHGANRSSMDEVNGSKYDYSDGIL 1088 >SPAC30D11.09 |cwf19||complexed with Cdc5 protein Cwf19 |Schizosaccharomyces pombe|chr 1|||Manual Length = 639 Score = 26.2 bits (55), Expect = 4.0 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -1 Query: 450 SIDGQSPHVVKSRIKWQTGAHPQ--KHVCAEVITRCPEVI 337 SIDG HVV+ W G H Q + V A ++ PEVI Sbjct: 570 SIDGGYGHVVEDEKAW--GRHDQVPRQVFASMLNLPPEVI 607 >SPAC3F10.06c |||initiator methionine tRNA 2'-O-ribosyl phosphate transferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 453 Score = 25.4 bits (53), Expect = 7.0 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 495 WYV*RVHAVISMLGRSIDGQS 433 WYV R HA IS+ +S DG + Sbjct: 55 WYVNRRHAPISVYFKSTDGHT 75 >SPBP22H7.09c |mis15||kinetochore protein Mis15 |Schizosaccharomyces pombe|chr 2|||Manual Length = 409 Score = 25.0 bits (52), Expect = 9.3 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 214 ELNYFLSYQYCRSLGLQLASFETKEKADSITTYLTNAGYNK 336 ++ Y+ +Y Y G L + K ++TT+ TN G NK Sbjct: 211 QMFYYTTYFYEMMSGSALRPIDLVSK--NLTTFCTNVGVNK 249 >SPAC19A8.04 |erg5||C-22 sterol desaturase Erg5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 541 Score = 25.0 bits (52), Expect = 9.3 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = -1 Query: 468 ISMLGRSIDGQSPHVVKSRIKWQTG 394 I +G +D P K KWQTG Sbjct: 59 IPFMGSFLDSMKPTFEKYNAKWQTG 83 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,676,058 Number of Sequences: 5004 Number of extensions: 55930 Number of successful extensions: 132 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 132 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 287744314 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -