SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--2395
         (483 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

06_03_0783 - 24546403-24546765,24547202-24547262,24547899-245480...    27   7.9  

>06_03_0783 -
           24546403-24546765,24547202-24547262,24547899-24548004,
           24548118-24551600,24553134-24553179
          Length = 1352

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 17/50 (34%), Positives = 29/50 (58%)
 Frame = +2

Query: 17  PPIVRPSNIVINKINFLCACFVRVRINSNLISANAERLAFIVISLEASDF 166
           PP VR  +I+  +I+ LC C ++ R+ + LI  N +R     + +EA+ F
Sbjct: 577 PPAVRHLSILAERIDLLCTCKLQ-RLRT-LIIWNKDRCFCPRVCVEANFF 624


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,887,341
Number of Sequences: 37544
Number of extensions: 214600
Number of successful extensions: 495
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 490
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 495
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 987904180
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -