SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--2393
         (499 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ780964-1|CAG62942.2|  332|Apis mellifera putative corticotropi...    23   2.3  
AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced prot...    23   2.3  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              21   7.1  
AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             21   7.1  

>AJ780964-1|CAG62942.2|  332|Apis mellifera putative corticotropin
           releasing hormone-binding protein protein.
          Length = 332

 Score = 22.6 bits (46), Expect = 2.3
 Identities = 13/48 (27%), Positives = 19/48 (39%)
 Frame = +1

Query: 256 TSIEESVVVIYDTKKSARGFLTLKAYRLTPQAIAMYKEGDYTPEALRN 399
           TS +   V+ Y   KS +GF     +   P+   +       P  LRN
Sbjct: 163 TSSQNIAVIEYRIPKSGKGFSLFARFLKNPRPCNVLATSLTEPYTLRN 210


>AB264313-1|BAF43600.1|  900|Apis mellifera ecdysone-induced protein
           75 protein.
          Length = 900

 Score = 22.6 bits (46), Expect = 2.3
 Identities = 12/38 (31%), Positives = 17/38 (44%)
 Frame = -1

Query: 130 GIPPHPWCRHALEMGSSW*SPDGSQRPNQGELPEPPPC 17
           G+ PH   R     GS+    D   R +  + P+PP C
Sbjct: 534 GLCPH---RRRANSGSTSSGDDELHRASLSKTPQPPQC 568


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 21.0 bits (42), Expect = 7.1
 Identities = 8/12 (66%), Positives = 10/12 (83%)
 Frame = -2

Query: 315 ESSG*FLCIVNH 280
           E SG +LCIVN+
Sbjct: 280 EDSGKYLCIVNN 291


>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 21.0 bits (42), Expect = 7.1
 Identities = 7/12 (58%), Positives = 9/12 (75%)
 Frame = -2

Query: 177 KMINIDSSKPPH 142
           K +N D S+PPH
Sbjct: 800 KSVNGDQSQPPH 811


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 142,309
Number of Sequences: 438
Number of extensions: 3075
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 13618701
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -