SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--2307
         (473 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC4B3.10c |ipk1||inositol 1,3,4,5,6-pentakisphosphate |Schizos...    25   7.8  

>SPCC4B3.10c |ipk1||inositol 1,3,4,5,6-pentakisphosphate
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 640

 Score = 24.6 bits (51), Expect = 7.8
 Identities = 14/34 (41%), Positives = 20/34 (58%)
 Frame = +3

Query: 183 KRWEDNLMRLNLSVDIPHKHSPLSFAPDLLSGSR 284
           K  +  L+R+N  +D   KH  LSF P L++ SR
Sbjct: 166 KALQSQLVRVNGELDDLQKHLTLSF-PTLIAKSR 198


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,733,536
Number of Sequences: 5004
Number of extensions: 31141
Number of successful extensions: 54
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 54
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 54
length of database: 2,362,478
effective HSP length: 67
effective length of database: 2,027,210
effective search space used: 182448900
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -