Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--1781
         (552 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice...    25   0.67 
EF531707-1|ABP57431.1|  138|Apis mellifera structural cuticle pr...    22   4.8  
AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.       21   8.3  

>AY268031-1|AAP23056.1|  810|Apis mellifera dorsal protein splice
           variant B protein.
          Length = 810

 Score = 24.6 bits (51), Expect = 0.67
 Identities = 13/43 (30%), Positives = 18/43 (41%)
 Frame = +1

Query: 283 PTGRRGDSRRPTTSVSAVRGPYQAARAVPLVFRDTPLGQNQPA 411
           PT R     +P      ++ P   A + P  F   PLG  +PA
Sbjct: 289 PTYRMQQVEQPVQVYIQLKRPSDGATSEPFPFLMLPLGAGRPA 331


>EF531707-1|ABP57431.1|  138|Apis mellifera structural cuticle
           protein protein.
          Length = 138

 Score = 21.8 bits (44), Expect = 4.8
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = -2

Query: 104 QIVESHIPRAPP 69
           Q+  SHIP APP
Sbjct: 97  QVQGSHIPTAPP 108


>AB270697-1|BAF75928.1|  735|Apis mellifera FoxP protein protein.
          Length = 735

 Score = 21.0 bits (42), Expect = 8.3
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +3

Query: 492 PHRSPQPPTR 521
           PH+SPQ P R
Sbjct: 27  PHQSPQAPQR 36


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 145,768
Number of Sequences: 438
Number of extensions: 3017
Number of successful extensions: 3
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 15827139
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)