Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--1751
         (496 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L01587-1|AAA27734.1|   69|Apis mellifera zinc finger protein pro...    23   2.4  
DQ667192-1|ABG75744.1|  489|Apis mellifera pH-sensitive chloride...    22   4.1  
DQ667191-1|ABG75743.1|  475|Apis mellifera pH-sensitive chloride...    22   4.1  
DQ667190-1|ABG75742.1|  509|Apis mellifera pH-sensitive chloride...    22   4.1  
DQ667189-1|ABG75741.1|  458|Apis mellifera pH-sensitive chloride...    22   4.1  
DQ325090-1|ABD14104.1|  178|Apis mellifera complementary sex det...    22   4.1  
DQ325083-1|ABD14097.1|  189|Apis mellifera complementary sex det...    22   4.1  
AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex det...    22   4.1  
AY569697-1|AAS86650.1|  413|Apis mellifera complementary sex det...    22   4.1  

>L01587-1|AAA27734.1|   69|Apis mellifera zinc finger protein
           protein.
          Length = 69

 Score = 22.6 bits (46), Expect = 2.4
 Identities = 13/55 (23%), Positives = 25/55 (45%)
 Frame = +1

Query: 73  NTYANKWFICERRRFDGVHRLMASPLYLFHQNVSSFIIHRRNLSVEFTQSPRLIL 237
           N + +K F CE+  +  V++ M +     H NV  +       + ++  S +L L
Sbjct: 10  NHFGSKPFKCEKCSYSCVNKSMLNSHLKSHSNVYQYRCANCTYATKYCHSLKLHL 64


>DQ667192-1|ABG75744.1|  489|Apis mellifera pH-sensitive chloride
           channel variant 4 protein.
          Length = 489

 Score = 21.8 bits (44), Expect = 4.1
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = -1

Query: 58  IHHLDT*FVK*TYFIM 11
           IHH D  ++  TYFIM
Sbjct: 136 IHHYDDIWLPDTYFIM 151


>DQ667191-1|ABG75743.1|  475|Apis mellifera pH-sensitive chloride
           channel variant 3 protein.
          Length = 475

 Score = 21.8 bits (44), Expect = 4.1
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = -1

Query: 58  IHHLDT*FVK*TYFIM 11
           IHH D  ++  TYFIM
Sbjct: 136 IHHYDDIWLPDTYFIM 151


>DQ667190-1|ABG75742.1|  509|Apis mellifera pH-sensitive chloride
           channel variant 1 protein.
          Length = 509

 Score = 21.8 bits (44), Expect = 4.1
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = -1

Query: 58  IHHLDT*FVK*TYFIM 11
           IHH D  ++  TYFIM
Sbjct: 187 IHHYDDIWLPDTYFIM 202


>DQ667189-1|ABG75741.1|  458|Apis mellifera pH-sensitive chloride
           channel protein.
          Length = 458

 Score = 21.8 bits (44), Expect = 4.1
 Identities = 9/16 (56%), Positives = 11/16 (68%)
 Frame = -1

Query: 58  IHHLDT*FVK*TYFIM 11
           IHH D  ++  TYFIM
Sbjct: 136 IHHYDDIWLPDTYFIM 151


>DQ325090-1|ABD14104.1|  178|Apis mellifera complementary sex
           determiner protein.
          Length = 178

 Score = 21.8 bits (44), Expect = 4.1
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = +3

Query: 228 FNLKFYYQNYLL 263
           +N K YY+NY++
Sbjct: 100 YNKKLYYKNYII 111


>DQ325083-1|ABD14097.1|  189|Apis mellifera complementary sex
           determiner protein.
          Length = 189

 Score = 21.8 bits (44), Expect = 4.1
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = +3

Query: 228 FNLKFYYQNYLL 263
           +N K YY+NY++
Sbjct: 111 YNKKLYYKNYII 122


>AY569705-1|AAS86658.1|  419|Apis mellifera complementary sex
           determiner protein.
          Length = 419

 Score = 21.8 bits (44), Expect = 4.1
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = +3

Query: 228 FNLKFYYQNYLL 263
           +N K YY+NY++
Sbjct: 341 YNKKLYYKNYII 352


>AY569697-1|AAS86650.1|  413|Apis mellifera complementary sex
           determiner protein.
          Length = 413

 Score = 21.8 bits (44), Expect = 4.1
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = +3

Query: 228 FNLKFYYQNYLL 263
           +N K YY+NY++
Sbjct: 336 YNKKLYYKNYII 347


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 133,798
Number of Sequences: 438
Number of extensions: 2767
Number of successful extensions: 9
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 53
effective length of database: 123,129
effective search space used: 13667319
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)