Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--1683
         (771 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Y09951-1|CAA71082.1|  107|Anopheles gambiae histone H2a protein.       27   0.64 

>Y09951-1|CAA71082.1|  107|Anopheles gambiae histone H2a protein.
          Length = 107

 Score = 27.1 bits (57), Expect = 0.64
 Identities = 16/61 (26%), Positives = 28/61 (45%), Gaps = 2/61 (3%)
 Frame = +3

Query: 357 PLARIKKIMKLDEEVKMISAEAPVLFAKAAEIFIHELTLRAWSHTEENK--RRTLQRNDI 530
           P+ RI ++++     + +   APV  A   E    E+   A +   +NK  RR + R  +
Sbjct: 11  PVGRIHRLLRKGNYAERVGPGAPVYLAAVMEYLAAEVLELAGNRARDNKKERRIIPRLQL 70

Query: 531 A 533
           A
Sbjct: 71  A 71


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 708,331
Number of Sequences: 2352
Number of extensions: 13302
Number of successful extensions: 38
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 37
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 38
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 80249979
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)