SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--1659
         (307 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC56F2.10c |alg5||dolichyl-phosphate beta-glucosyltransferase ...    24   4.4  
SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces po...    24   5.8  

>SPBC56F2.10c |alg5||dolichyl-phosphate beta-glucosyltransferase
           Alg5 |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 322

 Score = 24.2 bits (50), Expect = 4.4
 Identities = 7/13 (53%), Positives = 12/13 (92%)
 Frame = +2

Query: 41  YIRSFLLNCFHDI 79
           +IR+FL++CFH +
Sbjct: 208 FIRNFLMHCFHKL 220


>SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 2812

 Score = 23.8 bits (49), Expect = 5.8
 Identities = 15/49 (30%), Positives = 23/49 (46%)
 Frame = +1

Query: 43  HQIISFELFSRYSNIALLFEFPLHINMFGFFFKSKPLLIYFSI**WKIL 189
           +QI+++  F+ Y  +     FP     F  F    P+L Y +I  WK L
Sbjct: 520 YQILTY--FNMYRPLCFASIFPFIKQQFILFNDYSPMLSYEAIDYWKSL 566


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,072,081
Number of Sequences: 5004
Number of extensions: 18320
Number of successful extensions: 26
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 26
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26
length of database: 2,362,478
effective HSP length: 63
effective length of database: 2,047,226
effective search space used: 77794588
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -