BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1509 (710 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC694.02 |||DEAD/DEAH box helicase|Schizosaccharomyces pombe|c... 26 4.6 SPAC29B12.06c |rcd1||RNA-binding protein Rcd1 |Schizosaccharomyc... 26 6.1 >SPAC694.02 |||DEAD/DEAH box helicase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1717 Score = 26.2 bits (55), Expect = 4.6 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -2 Query: 496 ESIGIAGSD*CMTTTTLSRVYD*EDGIHVQKNHEPNYELNKS 371 E G+AG + M TT S + DGI ++ + P +E NK+ Sbjct: 1543 EFCGLAGYNESMVGTTSSFLDKVPDGIFLKTSRLPIFEANKA 1584 >SPAC29B12.06c |rcd1||RNA-binding protein Rcd1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 283 Score = 25.8 bits (54), Expect = 6.1 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +1 Query: 157 VLQTGTQYYCFAAEIDRTVVPTRAGFYTEPVK*IVRCFLR 276 + QT ++Y A+ ++ V+ F +K ++RC+LR Sbjct: 191 ICQTYERFYAVASVLNNMVMQLVDSFAFRLLKHVIRCYLR 230 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,070,530 Number of Sequences: 5004 Number of extensions: 64220 Number of successful extensions: 151 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 151 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 331187010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -