BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1508 (641 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q22U33 Cluster: Potassium cation channel protein; n=1; ... 33 5.9 UniRef50_A7TQH8 Cluster: Putative uncharacterized protein; n=1; ... 33 5.9 >UniRef50_Q22U33 Cluster: Potassium cation channel protein; n=1; Tetrahymena thermophila SB210|Rep: Potassium cation channel protein - Tetrahymena thermophila SB210 Length = 1069 Score = 33.1 bits (72), Expect = 5.9 Identities = 14/31 (45%), Positives = 22/31 (70%) Frame = +1 Query: 325 TFRQKANEPVRQTNICST*ELDPQPSAQKSE 417 TFR+++N ++Q NI + L PQP AQK++ Sbjct: 869 TFRKRSNSEIQQENISISKFLKPQPKAQKAK 899 >UniRef50_A7TQH8 Cluster: Putative uncharacterized protein; n=1; Vanderwaltozyma polyspora DSM 70294|Rep: Putative uncharacterized protein - Vanderwaltozyma polyspora DSM 70294 Length = 830 Score = 33.1 bits (72), Expect = 5.9 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +2 Query: 185 LPLFVYLYHSLSLSFTISICPQTKSLCAMGNRHSCILY 298 +P+ V LY +LS+ F+++IC +TKS A + + Y Sbjct: 252 IPMTVLLYLTLSIEFSLNICDETKSKIAYTEYYKRLTY 289 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 550,461,817 Number of Sequences: 1657284 Number of extensions: 9646052 Number of successful extensions: 23427 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23396 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 48126133708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -