BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1498 (650 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g36150.1 68414.m04494 protease inhibitor/seed storage/lipid t... 38 0.008 At1g21310.1 68414.m02662 proline-rich extensin-like family prote... 35 0.054 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 31 0.88 At5g29070.1 68418.m03617 expressed protein 30 1.2 At1g10170.1 68414.m01147 NF-X1 type zinc finger family protein c... 30 1.2 At5g41100.2 68418.m04997 expressed protein 29 2.0 At5g41100.1 68418.m04996 expressed protein 29 2.0 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 29 2.0 At3g53140.1 68416.m05856 O-diphenol-O-methyl transferase, putati... 29 3.5 At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identic... 28 4.7 At3g10070.1 68416.m01207 transcription initiation factor IID (TF... 28 4.7 At1g76930.2 68414.m08956 proline-rich extensin-like family prote... 28 4.7 At1g76930.1 68414.m08955 proline-rich extensin-like family prote... 28 4.7 At5g31873.1 68418.m03777 hypothetical protein 28 6.2 At5g28120.1 68418.m03396 hypothetical protein 28 6.2 At5g28110.1 68418.m03395 hypothetical protein 28 6.2 At3g30816.1 68416.m03949 hypothetical protein 28 6.2 At5g46830.1 68418.m05769 basic helix-loop-helix (bHLH) family pr... 27 8.2 At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 27 8.2 At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit... 27 8.2 At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit... 27 8.2 At3g18950.1 68416.m02405 transducin family protein / WD-40 repea... 27 8.2 >At1g36150.1 68414.m04494 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein low similarity to glucoamylase S1/S2 [Precursor] from Saccharomyces cerevisiae [SP|P08640], proteophosphoglycan from Leishmania major [GI:5420387]; contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 256 Score = 37.5 bits (83), Expect = 0.008 Identities = 22/63 (34%), Positives = 36/63 (57%), Gaps = 2/63 (3%) Frame = +3 Query: 99 VRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHA-APVEH-SSYIHASPVVQH 272 VRH P +H +P +SH++P + ++P + H+ P+V A +PV+ SS +SP Sbjct: 165 VRHSSPP---VSHSSPPVSHSSPPTSRSSPAVSHSSPVVAASSPVKAVSSSTASSPRAAS 221 Query: 273 FSP 281 SP Sbjct: 222 PSP 224 >At1g21310.1 68414.m02662 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 431 Score = 34.7 bits (76), Expect = 0.054 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 6/64 (9%) Frame = +3 Query: 123 QATAHYTPVLSHAAPVLTHAAPLIQHAGP--IVHAAPV--EHSSYIHASPVVQHFS--PV 284 Q+TA+Y S P + H P ++H P + H+ P +H Y P V+H+S PV Sbjct: 24 QSTANY--FYSSPPPPVKHYTPPVKHYSPPPVYHSPPPPKKHYEYKSPPPPVKHYSPPPV 81 Query: 285 QHAP 296 H+P Sbjct: 82 YHSP 85 Score = 29.1 bits (62), Expect = 2.7 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 13/67 (19%) Frame = +3 Query: 135 HYTPV-LSHAAP------VLTHAAPLIQHAGP--IVHAAPVEHSSYIHASPV--VQHFS- 278 HY+P + H+ P V P ++H P + H+ P Y++ SP V+H+S Sbjct: 75 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 134 Query: 279 -PVQHAP 296 PV H+P Sbjct: 135 PPVYHSP 141 Score = 29.1 bits (62), Expect = 2.7 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 13/67 (19%) Frame = +3 Query: 135 HYTPV-LSHAAP------VLTHAAPLIQHAGP--IVHAAPVEHSSYIHASPV--VQHFS- 278 HY+P + H+ P V P ++H P + H+ P Y++ SP V+H+S Sbjct: 103 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 162 Query: 279 -PVQHAP 296 PV H+P Sbjct: 163 PPVYHSP 169 Score = 29.1 bits (62), Expect = 2.7 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 13/67 (19%) Frame = +3 Query: 135 HYTPV-LSHAAP------VLTHAAPLIQHAGP--IVHAAPVEHSSYIHASPV--VQHFS- 278 HY+P + H+ P V P ++H P + H+ P Y++ SP V+H+S Sbjct: 131 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 190 Query: 279 -PVQHAP 296 PV H+P Sbjct: 191 PPVYHSP 197 Score = 29.1 bits (62), Expect = 2.7 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 13/67 (19%) Frame = +3 Query: 135 HYTPV-LSHAAP------VLTHAAPLIQHAGP--IVHAAPVEHSSYIHASPV--VQHFS- 278 HY+P + H+ P V P ++H P + H+ P Y++ SP V+H+S Sbjct: 159 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 218 Query: 279 -PVQHAP 296 PV H+P Sbjct: 219 PPVYHSP 225 Score = 29.1 bits (62), Expect = 2.7 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 13/67 (19%) Frame = +3 Query: 135 HYTPV-LSHAAP------VLTHAAPLIQHAGP--IVHAAPVEHSSYIHASPV--VQHFS- 278 HY+P + H+ P V P ++H P + H+ P Y++ SP V+H+S Sbjct: 187 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 246 Query: 279 -PVQHAP 296 PV H+P Sbjct: 247 PPVYHSP 253 Score = 29.1 bits (62), Expect = 2.7 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 13/67 (19%) Frame = +3 Query: 135 HYTPV-LSHAAP------VLTHAAPLIQHAGP--IVHAAPVEHSSYIHASPV--VQHFS- 278 HY+P + H+ P V P ++H P + H+ P Y++ SP V+H+S Sbjct: 215 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 274 Query: 279 -PVQHAP 296 PV H+P Sbjct: 275 PPVYHSP 281 Score = 29.1 bits (62), Expect = 2.7 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 13/67 (19%) Frame = +3 Query: 135 HYTPV-LSHAAP------VLTHAAPLIQHAGP--IVHAAPVEHSSYIHASPV--VQHFS- 278 HY+P + H+ P V P ++H P + H+ P Y++ SP V+H+S Sbjct: 243 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 302 Query: 279 -PVQHAP 296 PV H+P Sbjct: 303 PPVYHSP 309 Score = 29.1 bits (62), Expect = 2.7 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 13/67 (19%) Frame = +3 Query: 135 HYTPV-LSHAAP------VLTHAAPLIQHAGP--IVHAAPVEHSSYIHASPV--VQHFS- 278 HY+P + H+ P V P ++H P + H+ P Y++ SP V+H+S Sbjct: 271 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 330 Query: 279 -PVQHAP 296 PV H+P Sbjct: 331 PPVYHSP 337 Score = 29.1 bits (62), Expect = 2.7 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 13/67 (19%) Frame = +3 Query: 135 HYTPV-LSHAAP------VLTHAAPLIQHAGP--IVHAAPVEHSSYIHASPV--VQHFS- 278 HY+P + H+ P V P ++H P + H+ P Y++ SP V+H+S Sbjct: 299 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 358 Query: 279 -PVQHAP 296 PV H+P Sbjct: 359 PPVYHSP 365 Score = 29.1 bits (62), Expect = 2.7 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 13/67 (19%) Frame = +3 Query: 135 HYTPV-LSHAAP------VLTHAAPLIQHAGP--IVHAAPVEHSSYIHASPV--VQHFS- 278 HY+P + H+ P V P ++H P + H+ P Y++ SP V+H+S Sbjct: 327 HYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSP 386 Query: 279 -PVQHAP 296 PV H+P Sbjct: 387 PPVYHSP 393 Score = 28.3 bits (60), Expect = 4.7 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 6/43 (13%) Frame = +3 Query: 186 PLIQHAGP--IVHAAPVEHSSYIHASPV--VQHFS--PVQHAP 296 P ++H P + H+ P Y++ SP V+H+S PV H+P Sbjct: 71 PPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPPPVYHSP 113 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 30.7 bits (66), Expect = 0.88 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 5/44 (11%) Frame = +1 Query: 319 QLPSNTPIMSKIMLPRSMSSHIPSRIPTPAI-----TSPNTKPV 435 Q P+ + S++ P S S+ PS+ PTP + +PN+KPV Sbjct: 726 QAPTTSSETSQVPTPSSESNQSPSQAPTPILEPVHAPTPNSKPV 769 >At5g29070.1 68418.m03617 expressed protein Length = 307 Score = 30.3 bits (65), Expect = 1.2 Identities = 20/49 (40%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = +2 Query: 167 STDSRSPFDST-CRSYCSRRPRGTFFVYTCFASSPTLQPCATCSSRAPR 310 +T R P D T C S RP T T SSPT +P +CS AP+ Sbjct: 93 ATLDRRPTDWTRCGSDTQPRPWATQGATTGPESSPTCRPTGSCSVAAPQ 141 >At1g10170.1 68414.m01147 NF-X1 type zinc finger family protein contains Pfam PF01422: NF-X1 type zinc finger; similar to transcriptional repressor NF-X1 (SP:Q12986) [Homo sapiens]; similar to EST gb|T21002 Length = 1188 Score = 30.3 bits (65), Expect = 1.2 Identities = 21/52 (40%), Positives = 25/52 (48%) Frame = -3 Query: 522 RCGGQLCIRPCGWNHQAGVESIRLSRHHHHGFRVGTCDRRCGDPRRNMRTHT 367 RCG C R C H +S S G RV TC ++CG PR + R HT Sbjct: 720 RCGMHACARTC---HPEPCDSFNESEA---GMRV-TCRQKCGAPRTDCR-HT 763 >At5g41100.2 68418.m04997 expressed protein Length = 582 Score = 29.5 bits (63), Expect = 2.0 Identities = 23/88 (26%), Positives = 37/88 (42%), Gaps = 10/88 (11%) Frame = +3 Query: 99 VRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFS 278 +R PS A TPV S ++P+ T H+ + H++P+E H +S Sbjct: 346 MRQMTPSANAYILPTPVDSKSSPIFTKPVTQTNHSANLWHSSPLEPIKTAHKDAESNLYS 405 Query: 279 ----PVQHA------PVVHHAAIPIAVE 332 P +HA P +P+AV+ Sbjct: 406 RLPRPSEHAFSGPLKPSSTRLPVPVAVQ 433 >At5g41100.1 68418.m04996 expressed protein Length = 586 Score = 29.5 bits (63), Expect = 2.0 Identities = 23/88 (26%), Positives = 37/88 (42%), Gaps = 10/88 (11%) Frame = +3 Query: 99 VRHDEPSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFS 278 +R PS A TPV S ++P+ T H+ + H++P+E H +S Sbjct: 346 MRQMTPSANAYILPTPVDSKSSPIFTKPVTQTNHSANLWHSSPLEPIKTAHKDAESNLYS 405 Query: 279 ----PVQHA------PVVHHAAIPIAVE 332 P +HA P +P+AV+ Sbjct: 406 RLPRPSEHAFSGPLKPSSTRLPVPVAVQ 433 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 29.5 bits (63), Expect = 2.0 Identities = 15/49 (30%), Positives = 21/49 (42%) Frame = +3 Query: 174 THAAPLIQHAGPIVHAAPVEHSSYIHASPVVQHFSPVQHAPVVHHAAIP 320 T P H+ P +P Y ++SP H SP H+P H+ P Sbjct: 535 TRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPP 583 >At3g53140.1 68416.m05856 O-diphenol-O-methyl transferase, putative similar to GI:6688808 [Medicago sativa subsp. x varia], caffeic acid O-methyltransferase (homt1), Populus kitakamiensis, EMBL:PKHOMT1A Length = 359 Score = 28.7 bits (61), Expect = 3.5 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = +3 Query: 150 LSHAAPVLTHAAPLIQHAGPIVHAAPVE 233 LS+AA VL H + A P+VH A VE Sbjct: 115 LSYAAYVLQHHQEALMRAWPLVHTAVVE 142 >At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identical to gi_11935088_gb_AAG41964 Length = 209 Score = 28.3 bits (60), Expect = 4.7 Identities = 16/52 (30%), Positives = 25/52 (48%) Frame = +1 Query: 334 TPIMSKIMLPRSMSSHIPSRIPTPAITSPNTKPVMVMS*KANTLYSSLMVPS 489 +PI S P + S+ S +PA+TSP T P + A++ S P+ Sbjct: 23 SPISSPTKSPTTPSAPTTSPTKSPAVTSPTTAPAKTPTASASSPVESPKSPA 74 >At3g10070.1 68416.m01207 transcription initiation factor IID (TFIID) subunit A family protein similar to hypothetical protein GB:CAB10099 [Schizosaccharomyces pombe]; contains Pfam profile PF03847: Transcription initiation factor TFIID subunit A Length = 539 Score = 28.3 bits (60), Expect = 4.7 Identities = 20/85 (23%), Positives = 33/85 (38%), Gaps = 1/85 (1%) Frame = +3 Query: 114 PSHQATAHYTPVLSHAAPVLTHAAPLIQHAGPIVHAAP-VEHSSYIHASPVVQHFSPVQH 290 P+ + PV S A H + + P ++ P +HSSY H S Sbjct: 61 PNPNPPQYTRPVTSPATQQQQHLSQPLVRPPPQAYSRPWQQHSSYTHFSSASSPLLSSSS 120 Query: 291 APVVHHAAIPIAVEHSDHVEDHAPA 365 AP +++PI+ + + PA Sbjct: 121 APASSSSSLPISGQQRGGMAIGVPA 145 >At1g76930.2 68414.m08956 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 256 Score = 28.3 bits (60), Expect = 4.7 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 6/64 (9%) Frame = +3 Query: 135 HYTP--VLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSS----YIHASPVVQHFSPVQHAP 296 HY+P V P + H +P + P PV+H S Y P V+H+SP Sbjct: 108 HYSPPPVYKSPPPPVKHYSPPPVYKSP---PPPVKHYSPPPVYKSPPPPVKHYSPPPSYT 164 Query: 297 VVHH 308 +HH Sbjct: 165 TLHH 168 >At1g76930.1 68414.m08955 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 293 Score = 28.3 bits (60), Expect = 4.7 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 6/64 (9%) Frame = +3 Query: 135 HYTP--VLSHAAPVLTHAAPLIQHAGPIVHAAPVEHSS----YIHASPVVQHFSPVQHAP 296 HY+P V P + H +P + P PV+H S Y P V+H+SP Sbjct: 108 HYSPPPVYKSPPPPVKHYSPPPVYKSP---PPPVKHYSPPPVYKSPPPPVKHYSPPPSYT 164 Query: 297 VVHH 308 +HH Sbjct: 165 TLHH 168 >At5g31873.1 68418.m03777 hypothetical protein Length = 271 Score = 27.9 bits (59), Expect = 6.2 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -3 Query: 408 RRCGDPRRNMRTHTSREHDLRHDRSVRRQLESQRGARLEHVAQG 277 +R DPR N+R R H L +D V + G+ + HVA G Sbjct: 196 KRMLDPRANLRPTEERFHGLAYDDPVDESTDPW-GSIVHHVAGG 238 >At5g28120.1 68418.m03396 hypothetical protein Length = 506 Score = 27.9 bits (59), Expect = 6.2 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -3 Query: 408 RRCGDPRRNMRTHTSREHDLRHDRSVRRQLESQRGARLEHVAQG 277 +R DPR N+R R H L +D V + G+ + HVA G Sbjct: 394 KRMLDPRANLRPTEERFHGLAYDDPVDESTDPW-GSIVHHVAGG 436 >At5g28110.1 68418.m03395 hypothetical protein Length = 493 Score = 27.9 bits (59), Expect = 6.2 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -3 Query: 408 RRCGDPRRNMRTHTSREHDLRHDRSVRRQLESQRGARLEHVAQG 277 +R DPR N+R R H L +D V + G+ + HVA G Sbjct: 394 KRMLDPRANLRPTEERFHGLAYDDPVDESTDPW-GSIVHHVAGG 436 >At3g30816.1 68416.m03949 hypothetical protein Length = 342 Score = 27.9 bits (59), Expect = 6.2 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = -3 Query: 408 RRCGDPRRNMRTHTSREHDLRHDRSVRRQLESQRGARLEHVAQG 277 +R DPR N+R R H L +D V + G+ + HVA G Sbjct: 231 KRMLDPRANLRPTEERFHGLAYDDPVDESTDPW-GSIVHHVAGG 273 >At5g46830.1 68418.m05769 basic helix-loop-helix (bHLH) family protein Length = 511 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/35 (28%), Positives = 22/35 (62%) Frame = +3 Query: 420 QHETRDGDVVKGEYSLLQPDGSIRKVEYTADHHNG 524 ++E + +++K E +++ D ++ +VE DHH G Sbjct: 424 KYEEKASEMMKIEVKIMESDDAMVRVESRKDHHPG 458 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 27.5 bits (58), Expect = 8.2 Identities = 18/50 (36%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = -3 Query: 456 RLSRHHHHGFRVGTCDRRCGDPRRNMRTHTSREHDLRH-DRSVRRQLESQ 310 R SRH H G R G + R R+HD R DR RR S+ Sbjct: 99 RSSRHRDHSRERGERRERGGRDDDDYRRSRDRDHDRRRDDRGGRRSRRSR 148 >At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 542 Score = 27.5 bits (58), Expect = 8.2 Identities = 18/50 (36%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = -3 Query: 456 RLSRHHHHGFRVGTCDRRCGDPRRNMRTHTSREHDLRH-DRSVRRQLESQ 310 R SRH H G R G + R R+HD R DR RR S+ Sbjct: 99 RSSRHRDHSRERGERRERGGRDDDDYRRSRDRDHDRRRDDRGGRRSRRSR 148 >At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 573 Score = 27.5 bits (58), Expect = 8.2 Identities = 18/50 (36%), Positives = 21/50 (42%), Gaps = 1/50 (2%) Frame = -3 Query: 456 RLSRHHHHGFRVGTCDRRCGDPRRNMRTHTSREHDLRH-DRSVRRQLESQ 310 R SRH H G R G + R R+HD R DR RR S+ Sbjct: 99 RSSRHRDHSRERGERRERGGRDDDDYRRSRDRDHDRRRDDRGGRRSRRSR 148 >At3g18950.1 68416.m02405 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to En/Spm-like transposon protein GI:2739374 from [Arabidopsis thaliana]; no characterized homologs Length = 473 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -2 Query: 517 WWSAVYSTLRMEPSGWSREYSPFTTSP 437 +++ +T M PS W++ YSP+ SP Sbjct: 88 YYTDTTNTPSMSPSPWNQTYSPYYKSP 114 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,328,580 Number of Sequences: 28952 Number of extensions: 359136 Number of successful extensions: 1365 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 1270 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1361 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -