BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1494 (604 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23985| Best HMM Match : CRAM_rpt (HMM E-Value=3.4) 29 2.9 SB_35684| Best HMM Match : HELP (HMM E-Value=0.17) 28 5.1 SB_25725| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 >SB_23985| Best HMM Match : CRAM_rpt (HMM E-Value=3.4) Length = 323 Score = 29.1 bits (62), Expect = 2.9 Identities = 19/65 (29%), Positives = 29/65 (44%) Frame = +1 Query: 292 NRFDLENGNESTESIYQNRSAQELWPEGKMKDSDNKNRVKECNWSYENEVNVSDEKLREE 471 N D NG++ + ++ + E + +SD N E N S +E N SDE E Sbjct: 165 NESDESNGSDESNGSDESNESDESNESDESNESDESNESDESNGS--DESNESDES-NES 221 Query: 472 NTGNG 486 + NG Sbjct: 222 DESNG 226 >SB_35684| Best HMM Match : HELP (HMM E-Value=0.17) Length = 409 Score = 28.3 bits (60), Expect = 5.1 Identities = 17/61 (27%), Positives = 28/61 (45%), Gaps = 2/61 (3%) Frame = +1 Query: 316 NESTESIYQNRSAQELWPE--GKMKDSDNKNRVKECNWSYENEVNVSDEKLREENTGNGI 489 N+ I + R E W G D D+++ + N S +++N+S R + GNG Sbjct: 32 NQDKAEIEEARQKGEHWRNRGGLSSDEDSEHDYDKYNTSVNSQLNLSGSLNRSASQGNGW 91 Query: 490 I 492 I Sbjct: 92 I 92 >SB_25725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 489 Score = 28.3 bits (60), Expect = 5.1 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +3 Query: 480 QWNHKSFDATPKAIRPLMKRTTDIKPALLN-IDPDSASSPK 599 +WN K FD T +I+ + D+ P N ++PD S K Sbjct: 117 KWNEKDFDFTQSSIQ--LSAELDVSPFFTNKVEPDPRDSNK 155 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,690,658 Number of Sequences: 59808 Number of extensions: 342977 Number of successful extensions: 927 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 866 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 924 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1463691625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -