BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1494 (604 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 27 0.19 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.3 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 22 5.3 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 22 5.3 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 22 5.3 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 22 5.3 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 21 7.0 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 21 7.0 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 26.6 bits (56), Expect = 0.19 Identities = 18/51 (35%), Positives = 26/51 (50%) Frame = +1 Query: 334 IYQNRSAQELWPEGKMKDSDNKNRVKECNWSYENEVNVSDEKLREENTGNG 486 I QN + + W GK K+S N + E ++ EN +D+K E TG G Sbjct: 34 IIQNNNNDD-WSVGK-KNS-NSGTINESEFNDENYWQCNDKKTDIEETGRG 81 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 2.3 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +1 Query: 172 GWHFEISDRS*QLRQMSTGG 231 GW EISD+ +LR + G Sbjct: 85 GWETEISDQMLELRDLPISG 104 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 21.8 bits (44), Expect = 5.3 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +1 Query: 292 NRFDLENGNESTESIYQNRSAQELW 366 N F NG ST + N +A +W Sbjct: 342 NFFTTSNGFRSTLPVVSNLTAMNVW 366 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 21.8 bits (44), Expect = 5.3 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +1 Query: 292 NRFDLENGNESTESIYQNRSAQELW 366 N F NG ST + N +A +W Sbjct: 311 NFFTTSNGFRSTLPVVSNLTAMNVW 335 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 21.8 bits (44), Expect = 5.3 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +1 Query: 292 NRFDLENGNESTESIYQNRSAQELW 366 N F NG ST + N +A +W Sbjct: 362 NFFTTSNGFRSTLPVVSNLTAMNVW 386 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 21.8 bits (44), Expect = 5.3 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +1 Query: 292 NRFDLENGNESTESIYQNRSAQELW 366 N F NG ST + N +A +W Sbjct: 311 NFFTTSNGFRSTLPVVSNLTAMNVW 335 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.4 bits (43), Expect = 7.0 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = +2 Query: 149 INVTIQSLDGTLKLAIEVDN 208 +++T+Q++D T + VDN Sbjct: 188 VSLTVQAMDSTNTMVYMVDN 207 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.4 bits (43), Expect = 7.0 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 138 FVNKSREYYNITILTINTCLVS 73 F+NK+ +Y TILT L++ Sbjct: 84 FINKNDKYEENTILTTMPLLIN 105 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,244 Number of Sequences: 438 Number of extensions: 3495 Number of successful extensions: 12 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17726685 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -