BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1481 (614 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 22 3.6 AM292383-1|CAL23195.2| 320|Tribolium castaneum gustatory recept... 22 3.6 AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory recept... 22 3.6 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 22 3.6 AF264720-1|AAF75272.1| 126|Tribolium castaneum putative cytochr... 22 4.7 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 22.2 bits (45), Expect = 3.6 Identities = 11/53 (20%), Positives = 27/53 (50%) Frame = +2 Query: 125 DSPAIGLQKQPLFETNRNLFYKSIEDLIFKFRYKDAENHLIFAQHTTLKIINL 283 D P +K + +Y+S++D+I K + A + ++ + +K+I++ Sbjct: 223 DEPDHKWKKNDSSKKKTRYYYRSVDDVIEKGKRPGAFRTTLGSELSKVKVIDM 275 >AM292383-1|CAL23195.2| 320|Tribolium castaneum gustatory receptor candidate 62 protein. Length = 320 Score = 22.2 bits (45), Expect = 3.6 Identities = 10/28 (35%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +3 Query: 345 LINVLITMYSV-LIRRTSEQRRVWCKLL 425 +++V++ + +V I T +R WCKLL Sbjct: 63 ILDVILLILNVHTILTTITKRNQWCKLL 90 >AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory receptor candidate 37 protein. Length = 331 Score = 22.2 bits (45), Expect = 3.6 Identities = 10/28 (35%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +3 Query: 345 LINVLITMYSV-LIRRTSEQRRVWCKLL 425 +++V++ + +V I T +R WCKLL Sbjct: 63 ILDVILLILNVHTILTTITKRNQWCKLL 90 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 22.2 bits (45), Expect = 3.6 Identities = 10/28 (35%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +3 Query: 345 LINVLITMYSV-LIRRTSEQRRVWCKLL 425 +++V++ + +V I T +R WCKLL Sbjct: 383 ILDVILLILNVHTILTTITKRNQWCKLL 410 >AF264720-1|AAF75272.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q1 protein. Length = 126 Score = 21.8 bits (44), Expect = 4.7 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -2 Query: 565 HSEYTNSFESFVNRVIWENSTNPSFTSAQTL 473 HSE S + + V+ + S PS+ Q L Sbjct: 15 HSEVQESIVAEMREVLGDLSKKPSYNDLQNL 45 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,889 Number of Sequences: 336 Number of extensions: 2947 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15666150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -