BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1480 (653 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 30 0.022 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 25 0.84 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 29.9 bits (64), Expect = 0.022 Identities = 18/55 (32%), Positives = 25/55 (45%) Frame = +1 Query: 334 PGC*RGSSPTGSVNVRQGGAATPSGPPRQARSSSHHADASNPTSSSRHSSLYVNF 498 PGC + S QG A S P R+S + S+PT+S ++ VNF Sbjct: 893 PGCSSKNGEPTSAAFAQGFATAASSPGLLERASPAFSGTSSPTNSLVGKTVAVNF 947 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 24.6 bits (51), Expect = 0.84 Identities = 10/39 (25%), Positives = 20/39 (51%) Frame = +1 Query: 349 GSSPTGSVNVRQGGAATPSGPPRQARSSSHHADASNPTS 465 G++ + + GAA PP A S+ H A++ + ++ Sbjct: 253 GNAAGNNEDSSDSGAAASDRPPASASSNEHEAESEHTST 291 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,500 Number of Sequences: 438 Number of extensions: 2958 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -