BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1477 (697 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7... 25 1.7 AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase p... 25 2.3 AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8... 25 3.0 EF426194-1|ABO26437.1| 133|Anopheles gambiae unknown protein. 24 4.0 EF426193-1|ABO26436.1| 133|Anopheles gambiae unknown protein. 24 4.0 EF426192-1|ABO26435.1| 133|Anopheles gambiae unknown protein. 24 4.0 EF426191-1|ABO26434.1| 133|Anopheles gambiae unknown protein. 24 4.0 EF426190-1|ABO26433.1| 133|Anopheles gambiae unknown protein. 24 4.0 EF426189-1|ABO26432.1| 133|Anopheles gambiae unknown protein. 24 4.0 EF426188-1|ABO26431.1| 133|Anopheles gambiae unknown protein. 24 4.0 EF426187-1|ABO26430.1| 133|Anopheles gambiae unknown protein. 24 4.0 EF426186-1|ABO26429.1| 133|Anopheles gambiae unknown protein. 24 4.0 EF426185-1|ABO26428.1| 133|Anopheles gambiae unknown protein. 24 4.0 EF426184-1|ABO26427.1| 133|Anopheles gambiae unknown protein. 24 4.0 EF426183-1|ABO26426.1| 133|Anopheles gambiae unknown protein. 24 4.0 EF426182-1|ABO26425.1| 133|Anopheles gambiae unknown protein. 24 4.0 EF426181-1|ABO26424.1| 133|Anopheles gambiae unknown protein. 24 4.0 EF426180-1|ABO26423.1| 133|Anopheles gambiae unknown protein. 24 4.0 EF426179-1|ABO26422.1| 133|Anopheles gambiae unknown protein. 24 4.0 AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9... 24 4.0 AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase p... 24 4.0 AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase p... 24 4.0 AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase... 24 4.0 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 24 5.3 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 23 9.2 AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase... 23 9.2 >AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7 protein. Length = 696 Score = 25.4 bits (53), Expect = 1.7 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 Query: 158 LLHWHWCYVYACQG 199 L HWHW VY +G Sbjct: 220 LHHWHWHLVYPAEG 233 >AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 25.0 bits (52), Expect = 2.3 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 Query: 158 LLHWHWCYVYACQG 199 L HWHW VY +G Sbjct: 207 LHHWHWHLVYPARG 220 >AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8 protein. Length = 700 Score = 24.6 bits (51), Expect = 3.0 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 158 LLHWHWCYVYACQG 199 L HWHW VY G Sbjct: 221 LHHWHWHLVYPASG 234 >EF426194-1|ABO26437.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 596 TQIHECSRPWEDC 558 T H C+ PW DC Sbjct: 61 TLTHTCNTPWADC 73 >EF426193-1|ABO26436.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 596 TQIHECSRPWEDC 558 T H C+ PW DC Sbjct: 61 TLTHTCNTPWADC 73 >EF426192-1|ABO26435.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 596 TQIHECSRPWEDC 558 T H C+ PW DC Sbjct: 61 TLTHTCNTPWADC 73 >EF426191-1|ABO26434.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 596 TQIHECSRPWEDC 558 T H C+ PW DC Sbjct: 61 TLTHTCNTPWADC 73 >EF426190-1|ABO26433.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 596 TQIHECSRPWEDC 558 T H C+ PW DC Sbjct: 61 TLTHTCNTPWADC 73 >EF426189-1|ABO26432.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 596 TQIHECSRPWEDC 558 T H C+ PW DC Sbjct: 61 TLTHTCNTPWADC 73 >EF426188-1|ABO26431.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 596 TQIHECSRPWEDC 558 T H C+ PW DC Sbjct: 61 TLTHTCNTPWADC 73 >EF426187-1|ABO26430.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 596 TQIHECSRPWEDC 558 T H C+ PW DC Sbjct: 61 TLTHTCNTPWADC 73 >EF426186-1|ABO26429.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 596 TQIHECSRPWEDC 558 T H C+ PW DC Sbjct: 61 TLTHTCNTPWADC 73 >EF426185-1|ABO26428.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 596 TQIHECSRPWEDC 558 T H C+ PW DC Sbjct: 61 TLTHTCNTPWADC 73 >EF426184-1|ABO26427.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 596 TQIHECSRPWEDC 558 T H C+ PW DC Sbjct: 61 TLTHTCNTPWADC 73 >EF426183-1|ABO26426.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 596 TQIHECSRPWEDC 558 T H C+ PW DC Sbjct: 61 TLTHTCNTPWADC 73 >EF426182-1|ABO26425.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 596 TQIHECSRPWEDC 558 T H C+ PW DC Sbjct: 61 TLTHTCNTPWADC 73 >EF426181-1|ABO26424.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 596 TQIHECSRPWEDC 558 T H C+ PW DC Sbjct: 61 TLTHTCNTPWADC 73 >EF426180-1|ABO26423.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 596 TQIHECSRPWEDC 558 T H C+ PW DC Sbjct: 61 TLTHTCNTPWADC 73 >EF426179-1|ABO26422.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -3 Query: 596 TQIHECSRPWEDC 558 T H C+ PW DC Sbjct: 61 TLTHTCNTPWADC 73 >AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9 protein. Length = 685 Score = 24.2 bits (50), Expect = 4.0 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 Query: 158 LLHWHWCYVYACQG 199 L HWHW VY +G Sbjct: 207 LHHWHWHLVYPQEG 220 >AJ010195-1|CAA09034.1| 687|Anopheles gambiae prophenoloxidase protein. Length = 687 Score = 24.2 bits (50), Expect = 4.0 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 Query: 158 LLHWHWCYVYACQG 199 L HWHW VY +G Sbjct: 207 LHHWHWHLVYPGEG 220 >AJ010194-1|CAA09033.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 24.2 bits (50), Expect = 4.0 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 158 LLHWHWCYVYACQG 199 L HWHW VY G Sbjct: 207 LHHWHWHLVYPATG 220 >AF004916-1|AAB94672.1| 686|Anopheles gambiae pro-phenol oxidase subunit 2 protein. Length = 686 Score = 24.2 bits (50), Expect = 4.0 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 Query: 158 LLHWHWCYVYACQG 199 L HWHW VY +G Sbjct: 206 LHHWHWHLVYPGEG 219 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.8 bits (49), Expect = 5.3 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = +2 Query: 209 GFRIQRQDNSVPKILFLNGYSAGVSIVEFYSHEFIIVRVWRGDGHSTRVQTP 364 G I R+DN + ++L+ + S V V+ + HE V ++ HST P Sbjct: 436 GALIIRKDNDIQELLYDHDLSEHVITVQDWGHE-QGVSLFASHHHSTGDNKP 486 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 23.0 bits (47), Expect = 9.2 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 179 NTSASGEDKKPSEIKPSTSDQ 117 N +SGE +K +IKP+ Q Sbjct: 94 NRESSGEGEKKKKIKPNKEQQ 114 >AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase subunit 1 protein. Length = 688 Score = 23.0 bits (47), Expect = 9.2 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 164 HWHWCYVYACQG 199 HWHW VY G Sbjct: 208 HWHWHLVYPGDG 219 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 741,005 Number of Sequences: 2352 Number of extensions: 16233 Number of successful extensions: 68 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 62 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70668195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -