BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1475 (689 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 193 2e-51 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 6.3 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 6.3 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 22 6.3 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 193 bits (470), Expect = 2e-51 Identities = 98/123 (79%), Positives = 101/123 (82%) Frame = -3 Query: 666 LEKSYELPDGQVITIGNERFRCPEALFPTLVLGYGSLRHPRDHI*LHHEVRRGIRKDLYA 487 LEKSYELPDGQVITIGNERFRCPEALF LG + + IRKDLYA Sbjct: 11 LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYA 70 Query: 486 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQM 307 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPE+KYSVWIGGSILASLSTFQQM Sbjct: 71 NTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPEKKYSVWIGGSILASLSTFQQM 130 Query: 306 WIS 298 WIS Sbjct: 131 WIS 133 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.8 bits (44), Expect = 6.3 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -2 Query: 481 RIVRWYHHVPWNRRPYAK 428 RI+ +YH +++PY K Sbjct: 424 RIIDYYHSYKMHQKPYNK 441 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.8 bits (44), Expect = 6.3 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -2 Query: 481 RIVRWYHHVPWNRRPYAK 428 RI+ +YH +++PY K Sbjct: 424 RIIDYYHSYKMHQKPYNK 441 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 21.8 bits (44), Expect = 6.3 Identities = 12/52 (23%), Positives = 21/52 (40%) Frame = +1 Query: 175 LTEITSLN*AAGRGLLEAATRGAFRSTPVYNGGARLVVLLFRDPHLLEGREG 330 + E+ N GLL G + S + G + ++ +DP L+ G Sbjct: 310 VAEVMDRNGVLFFGLLSDLAIGCWNSEHFFEYGGNNIEIIVKDPETLQFPSG 361 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,498 Number of Sequences: 438 Number of extensions: 4554 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -