BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1474 (535 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 22 3.9 AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 21 6.8 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 21.8 bits (44), Expect = 3.9 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +1 Query: 316 PPIADLTWSVYRMCNFPRSLVSSTLP*TRRRSMESFTRR 432 PP+ T +V + RSL+ LP R S E R+ Sbjct: 119 PPMPITTDNVAAISGVLRSLLDRPLPAPERPSFEGLKRQ 157 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 21.0 bits (42), Expect = 6.8 Identities = 10/36 (27%), Positives = 16/36 (44%) Frame = +2 Query: 380 LLLCPEREGALWSHLLAGRYVQKTIVCAHAPNAKKR 487 +L P + W L +++ + HAP KKR Sbjct: 101 ILTTPFKLPYFWKMLTGFGKIEQVLPPHHAPEEKKR 136 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,486 Number of Sequences: 336 Number of extensions: 2936 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12992348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -