BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1472 (621 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 23 2.4 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 4.2 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 21 9.7 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 21 9.7 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 9.7 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 21 9.7 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 21 9.7 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 21 9.7 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 21 9.7 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 21 9.7 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 21 9.7 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 21 9.7 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 21 9.7 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 9.7 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 9.7 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 9.7 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 21 9.7 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 9.7 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 9.7 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 21 9.7 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 21 9.7 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 9.7 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 9.7 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 21 9.7 AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 21 9.7 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 23.0 bits (47), Expect = 2.4 Identities = 11/39 (28%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Frame = +3 Query: 69 PVCGNNGLTYFSPC--HAGCAKFSSHRSNFTNCACVHEN 179 PVC +NG Y + C H S + C+H + Sbjct: 116 PVCASNGKIYANHCELHRAACHSGSSLTKSRLMRCLHHD 154 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 22.2 bits (45), Expect = 4.2 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -2 Query: 455 YVSKQTEYHKLHTESKR 405 Y K Y KLH E K+ Sbjct: 245 YKKKDRRYEKLHNEKKK 261 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 455 YVSKQTEYHKLHTESKR 405 Y K +Y KLH E ++ Sbjct: 12 YRKKDRQYEKLHNEKEK 28 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 455 YVSKQTEYHKLHTESKR 405 Y K +Y KLH E ++ Sbjct: 12 YRKKDRQYEKLHNEKEK 28 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 455 YVSKQTEYHKLHTESKR 405 Y K +Y KLH E ++ Sbjct: 12 YRKKDRQYEKLHNEKEK 28 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 455 YVSKQTEYHKLHTESKR 405 Y K +Y KLH E ++ Sbjct: 12 YRKKDRQYEKLHNEKEK 28 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 455 YVSKQTEYHKLHTESKR 405 Y K +Y KLH E ++ Sbjct: 12 YRKKDRQYEKLHNEKEK 28 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 455 YVSKQTEYHKLHTESKR 405 Y K +Y KLH E ++ Sbjct: 12 YRKKDRQYEKLHNEKEK 28 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 455 YVSKQTEYHKLHTESKR 405 Y K +Y KLH E ++ Sbjct: 12 YRKKDRQYEKLHNEKEK 28 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 455 YVSKQTEYHKLHTESKR 405 Y K +Y KLH E ++ Sbjct: 12 YRKKDRQYEKLHNEKEK 28 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 455 YVSKQTEYHKLHTESKR 405 Y K +Y KLH E ++ Sbjct: 12 YRKKDRQYEKLHNEKEK 28 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 455 YVSKQTEYHKLHTESKR 405 Y K +Y KLH E ++ Sbjct: 12 YRKKDRQYEKLHNEKEK 28 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 455 YVSKQTEYHKLHTESKR 405 Y K +Y KLH E ++ Sbjct: 12 YRKKDRQYEKLHNEKEK 28 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 455 YVSKQTEYHKLHTESKR 405 Y K +Y KLH E ++ Sbjct: 245 YRKKDRQYEKLHNEKEK 261 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 455 YVSKQTEYHKLHTESKR 405 Y K +Y KLH E ++ Sbjct: 234 YRKKDRQYEKLHNEKEK 250 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 455 YVSKQTEYHKLHTESKR 405 Y K +Y KLH E ++ Sbjct: 245 YRKKDRQYEKLHNEKEK 261 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 455 YVSKQTEYHKLHTESKR 405 Y K +Y KLH E ++ Sbjct: 234 YRKKDRQYEKLHNEKEK 250 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 455 YVSKQTEYHKLHTESKR 405 Y K +Y KLH E ++ Sbjct: 245 YRKKDRQYEKLHNEKEK 261 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 455 YVSKQTEYHKLHTESKR 405 Y K +Y KLH E ++ Sbjct: 245 YRKKDRQYEKLHNEKEK 261 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 455 YVSKQTEYHKLHTESKR 405 Y K +Y KLH E ++ Sbjct: 234 YRKKDRQYEKLHNEKEK 250 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 455 YVSKQTEYHKLHTESKR 405 Y K +Y KLH E ++ Sbjct: 245 YRKKDRQYEKLHNEKEK 261 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 455 YVSKQTEYHKLHTESKR 405 Y K +Y KLH E ++ Sbjct: 245 YRKKDRQYEKLHNEKEK 261 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 455 YVSKQTEYHKLHTESKR 405 Y K +Y KLH E ++ Sbjct: 245 YRKKDRQYEKLHNEKEK 261 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 455 YVSKQTEYHKLHTESKR 405 Y K +Y KLH E ++ Sbjct: 234 YRKKDRQYEKLHNEKEK 250 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +2 Query: 26 RVQFKLPVHGDGHGTGL 76 R++ + V GDG+G G+ Sbjct: 475 RIRTSINVLGDGYGAGI 491 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,451 Number of Sequences: 438 Number of extensions: 3489 Number of successful extensions: 51 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18460203 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -