BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1468 (764 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 24 1.3 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 9.5 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 9.5 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 24.2 bits (50), Expect = 1.3 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +3 Query: 132 NALTKTRPSAYPATNLLPCWPKTAVTVLPLMTAC 233 + L +T P Y T + WPK VT + + C Sbjct: 203 DVLVETEPIYYNLTMVKLNWPKKRVTKMSSINPC 236 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.4 bits (43), Expect = 9.5 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +3 Query: 132 NALTKTRPSAYPATNLLPCWPKTAVTVLPLMTACGPKSRR 251 +A + PSA P+ L T T L +++ KSRR Sbjct: 691 HASSPLEPSAVPSKFCLSVTLLTVATSLVIVSRYAEKSRR 730 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.4 bits (43), Expect = 9.5 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -3 Query: 558 SNSDSLTLLFPVSI 517 SNSDSL++ P SI Sbjct: 48 SNSDSLSMTIPPSI 61 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 224,456 Number of Sequences: 438 Number of extensions: 4887 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23911269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -