BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1468 (764 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g32420.1 68417.m04615 peptidyl-prolyl cis-trans isomerase cyc... 34 0.090 At1g01690.1 68414.m00087 expressed protein 30 1.9 At4g10360.1 68417.m01701 expressed protein 28 5.9 >At4g32420.1 68417.m04615 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein weak similarity to CARS-Cyp [Homo sapiens] GI:1117968; contains Pfam profile PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type Length = 837 Score = 34.3 bits (75), Expect = 0.090 Identities = 29/69 (42%), Positives = 38/69 (55%) Frame = +1 Query: 190 GRKPP*RYYR**QRVGQNPGVIGDKS*FLDISRSPIRAVCPPPLKRRSIFCALPISTPWS 369 GR PP RY R + V +PG+ + SRSPIR+ PP KRRS + +S S Sbjct: 732 GRTPP-RYRRRSRSV--SPGLCYRNRRY---SRSPIRSRSPPYRKRRSPSASHSLSPSRS 785 Query: 370 RALSKSTAK 396 R+ SKS +K Sbjct: 786 RSRSKSYSK 794 >At1g01690.1 68414.m00087 expressed protein Length = 742 Score = 29.9 bits (64), Expect = 1.9 Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 2/75 (2%) Frame = +3 Query: 381 EIDGKNIYAQIIDLTTREAVENRPEVHRRYIDIQFLAWGEEKMALLLIREIIKSANHY*S 560 E D N YA + D P +H + FL WG +A+ L++ ++ + + Sbjct: 640 ETDDDNPYAMLPDFPRNPPP---PALHHHSMSAWFL-WGVRSVAVYLLKTHSGESDLFAT 695 Query: 561 SAILFF--IMITLLK 599 A+LFF ITLLK Sbjct: 696 GALLFFHAYCITLLK 710 >At4g10360.1 68417.m01701 expressed protein Length = 266 Score = 28.3 bits (60), Expect = 5.9 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 5/47 (10%) Frame = +3 Query: 33 FH--KFLLPLKWTSLSTVPPAMPSCNVSW---ITLLPLNALTKTRPS 158 FH K + PL + SL T+PPA+ N+ W IT + L+K + S Sbjct: 215 FHQVKQVFPLGFYSLLTIPPALAVMNLLWFWKITKGLIKTLSKAKTS 261 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,432,557 Number of Sequences: 28952 Number of extensions: 371296 Number of successful extensions: 989 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 962 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 989 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1712086600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -