BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1465 (661 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81137-3|CAB03471.1| 338|Caenorhabditis elegans Hypothetical pr... 27 8.9 AF068716-3|ABQ13069.1| 208|Caenorhabditis elegans Hypothetical ... 27 8.9 AF022975-4|AAB70673.1| 214|Caenorhabditis elegans Hypothetical ... 27 8.9 >Z81137-3|CAB03471.1| 338|Caenorhabditis elegans Hypothetical protein W02D9.4 protein. Length = 338 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 3/32 (9%) Frame = +1 Query: 568 LFTEMLVLGL---FIGVFEPLLYNKVHCFAHN 654 LFT +L+L L FI V ++Y K+ CF N Sbjct: 254 LFTNLLLLNLKLLFINVLSQVIYLKMQCFFPN 285 >AF068716-3|ABQ13069.1| 208|Caenorhabditis elegans Hypothetical protein F26D11.13 protein. Length = 208 Score = 27.5 bits (58), Expect = 8.9 Identities = 11/42 (26%), Positives = 22/42 (52%) Frame = -2 Query: 591 KNQHFCK*CYKNELCSVSCIKKSNTDFMNCD*FIAMNVSTVE 466 KN + CK CYK+ + + + +S + F + N+ T++ Sbjct: 90 KNFNMCKECYKDATNATNALNESAESIIQFSEFTSENLKTIQ 131 >AF022975-4|AAB70673.1| 214|Caenorhabditis elegans Hypothetical protein K09C6.6 protein. Length = 214 Score = 27.5 bits (58), Expect = 8.9 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -3 Query: 296 QILRSNKQRDLTETKKKLPETMQ*TMKSSNYFEYY 192 Q+L Q+ LT T P+++Q SNY YY Sbjct: 174 QLLGRKSQQMLTHTMSVAPKSLQLLQLCSNYSNYY 208 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,271,313 Number of Sequences: 27780 Number of extensions: 242634 Number of successful extensions: 483 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 473 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 483 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1476380920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -