BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1460 (642 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g31875.1 68417.m04529 expressed protein 29 2.6 At5g43030.1 68418.m05250 DC1 domain-containing protein contains ... 27 8.0 >At4g31875.1 68417.m04529 expressed protein Length = 138 Score = 29.1 bits (62), Expect = 2.6 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +1 Query: 388 ERTNEDKICAVKKFPLPKTQKEIKSFLDLIVYYRKLIQDFE 510 E T+E C ++K+ L +T S +D V YR+LI DF+ Sbjct: 2 EETSESLACRLEKYKLIET-----STIDTAVSYRRLILDFD 37 >At5g43030.1 68418.m05250 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 564 Score = 27.5 bits (58), Expect = 8.0 Identities = 22/68 (32%), Positives = 31/68 (45%) Frame = -3 Query: 625 IWIL*DRALINTCLHFSKAYMYPSVNTSLLFFFKYFVSFQNLESTFCSKLLNLRMILFLS 446 I L D L TC + SK +PS + L + +Y+V+ + F + N R S Sbjct: 288 ICTLCDFVLHETCANLSKKKRHPSESRRLTLYDEYYVNSLMRKGPFICFVCNQR----CS 343 Query: 445 GF*VVEIS 422 GF VE S Sbjct: 344 GFAYVEDS 351 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,003,856 Number of Sequences: 28952 Number of extensions: 219108 Number of successful extensions: 412 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 407 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 412 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1324661040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -