BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1459 (621 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 25 0.45 DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor p... 23 2.4 DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor p... 23 2.4 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 4.2 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 21 9.7 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 21 9.7 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 25.4 bits (53), Expect = 0.45 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +2 Query: 512 NQGCGWRNPDGVAFRTTGDVDGETKFGEFPWMVAI 616 N CGW+NP + T T EFP M I Sbjct: 150 NCNCGWKNPSRIVGGT------NTGINEFPMMAGI 178 >DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor protein. Length = 157 Score = 23.0 bits (47), Expect = 2.4 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -1 Query: 459 REPDSRRRCTMNTGHC 412 R+PD +C GHC Sbjct: 28 RQPDGMNQCQAVNGHC 43 >DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor protein. Length = 128 Score = 23.0 bits (47), Expect = 2.4 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -1 Query: 459 REPDSRRRCTMNTGHC 412 R+PD +C GHC Sbjct: 28 RQPDGMNQCQAVNGHC 43 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 22.2 bits (45), Expect = 4.2 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -1 Query: 570 TSPVVRKATPSGFRQPQPWFMAGSP 496 +S +V + +PS R P P + P Sbjct: 29 SSSIVDRRSPSSSRSPSPSLLTSQP 53 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -3 Query: 310 VWHERSSFVETPGTRVDGACQRH 242 VW E S T G RV+G H Sbjct: 401 VWRETISSTATLGFRVEGIKLAH 423 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -3 Query: 310 VWHERSSFVETPGTRVDGACQRH 242 VW E S T G RV+G H Sbjct: 316 VWRETISSTATLGFRVEGIKLAH 338 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -3 Query: 310 VWHERSSFVETPGTRVDGACQRH 242 VW E S T G RV+G H Sbjct: 635 VWRETISSTATLGFRVEGIKLAH 657 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,860 Number of Sequences: 438 Number of extensions: 3231 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18460203 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -