BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1456 (629 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 25 0.80 L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein pro... 21 9.9 DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II lar... 21 9.9 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 21 9.9 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 9.9 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 9.9 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 24.6 bits (51), Expect = 0.80 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 504 LPPDGEWLPSPMDFSNARG 560 LPPD W P + F+NA G Sbjct: 103 LPPDKVWKPDIVLFNNADG 121 >L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein protein. Length = 81 Score = 21.0 bits (42), Expect = 9.9 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = +1 Query: 505 CHLMVSGYRRPW 540 CHL + RPW Sbjct: 45 CHLCGKAFSRPW 56 >DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II large subunit protein. Length = 296 Score = 21.0 bits (42), Expect = 9.9 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +2 Query: 53 LVSLHGQVPPPCLILP 100 L S G++P PC++ P Sbjct: 28 LPSWDGKMPQPCILKP 43 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.0 bits (42), Expect = 9.9 Identities = 13/49 (26%), Positives = 24/49 (48%) Frame = -3 Query: 351 TVYLVVTAKFPVLRSSHIVVLNWFFFSLFVWVASSQPTWC*VVTEAHRH 205 TV+L + A+ S + +L +F + VASS + ++ HR+ Sbjct: 274 TVFLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRN 322 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.0 bits (42), Expect = 9.9 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -1 Query: 449 FCVVMLLILNVFNSVVVTRSEIVLN 375 F + + L+L++FN VVV + LN Sbjct: 601 FSLGLFLLLDMFNCVVVEETIPSLN 625 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.0 bits (42), Expect = 9.9 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +2 Query: 170 YISSWVAHLRCRCLWASVT 226 ++ W H +CR ASVT Sbjct: 426 FVEFWEHHFQCRYPNASVT 444 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,358 Number of Sequences: 438 Number of extensions: 4318 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18826962 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -