BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1455 (546 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 22 3.0 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 22 3.0 AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 22 4.0 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 4.0 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 22 4.0 AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein p... 22 4.0 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 22 4.0 AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 21 9.3 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 22.2 bits (45), Expect = 3.0 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 395 RLARYYKTKSVLPPNWK 445 RL Y T+SVL +WK Sbjct: 159 RLRMYINTESVLDGDWK 175 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 22.2 bits (45), Expect = 3.0 Identities = 7/9 (77%), Positives = 9/9 (100%) Frame = -3 Query: 325 LSHCNSFLD 299 LSHCNS++D Sbjct: 246 LSHCNSYVD 254 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 21.8 bits (44), Expect = 4.0 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -2 Query: 239 DLFASYESYLGNSM*IPQHYTN 174 D + +Y S + N+ +P HY+N Sbjct: 20 DNYYNYTSDIPNAQQMPPHYSN 41 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.8 bits (44), Expect = 4.0 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 62 PVGAALPPQCP 94 PVG ALPP P Sbjct: 120 PVGVALPPTLP 130 Score = 20.6 bits (41), Expect = 9.3 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -2 Query: 188 QHYTNL*GSETLLS 147 QHYTN+ E ++S Sbjct: 502 QHYTNIISQEQIIS 515 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.8 bits (44), Expect = 4.0 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -2 Query: 320 SLQQLS*SGSKDPPVSQELDPLLHDTEDLFASYES 216 SL++L+ G+K ++ E L + EDL +Y S Sbjct: 141 SLKRLNLKGNKIATIAYETFQNLPELEDLDLAYNS 175 >AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein protein. Length = 210 Score = 21.8 bits (44), Expect = 4.0 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -2 Query: 239 DLFASYESYLGNSM*IPQHYTN 174 D + +Y S + N+ +P HY+N Sbjct: 20 DNYYNYTSDIPNAQQMPPHYSN 41 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 21.8 bits (44), Expect = 4.0 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -2 Query: 239 DLFASYESYLGNSM*IPQHYTN 174 D + +Y S + N+ +P HY+N Sbjct: 20 DNYYNYTSDIPNAQQMPPHYSN 41 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 20.6 bits (41), Expect = 9.3 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +2 Query: 80 PPQCPYLVEIDCR 118 PP+CP + E C+ Sbjct: 30 PPRCPPIYEPSCQ 42 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,302 Number of Sequences: 336 Number of extensions: 2433 Number of successful extensions: 9 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13411456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -