BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1454 (705 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1731 - 29102403-29102720,29103529-29103735,29103937-291052... 33 0.22 10_08_0172 - 15406961-15407488,15408068-15408187,15408308-154085... 31 1.2 07_03_0879 - 22256033-22256173,22256417-22256492,22256830-222572... 30 1.6 03_01_0389 + 3021849-3022136,3022237-3022753,3022835-3022988,302... 30 1.6 02_04_0657 + 24786717-24786924,24786925-24786965,24787379-247875... 30 1.6 05_03_0250 + 10955281-10955419,10955524-10955727,10955985-109560... 30 2.1 10_08_0439 - 17926021-17927133 29 2.7 12_02_0030 + 12469707-12469902,12470337-12470658,12472208-124722... 29 3.6 03_06_0199 + 32310272-32311432 29 3.6 10_08_0936 - 21679002-21679800,21679893-21680116,21681174-216813... 29 4.8 09_06_0322 - 22329897-22330078,22330569-22331928 29 4.8 06_03_0896 + 25753377-25754325,25755081-25755691 29 4.8 09_04_0435 - 17545879-17546605,17546721-17546782,17547123-175473... 28 6.3 02_05_0398 - 28644632-28644889,28644997-28645032,28645101-286453... 28 6.3 01_07_0384 + 43209423-43210241 28 6.3 12_01_0421 - 3321590-3323692 28 8.3 12_01_0014 + 105422-105520,105598-105725,105939-106101,106198-10... 28 8.3 11_06_0490 - 24293218-24293373,24293454-24293521,24293845-242939... 28 8.3 11_01_0014 + 108647-108816,109704-109803,109891-110018,110232-11... 28 8.3 08_02_0204 - 14253258-14253383,14253685-14253878,14254029-142547... 28 8.3 06_03_0893 - 25721576-25722205,25722366-25722443,25722628-25723560 28 8.3 06_03_0347 + 19783824-19784348 28 8.3 02_05_0868 + 32342967-32343915,32344389-32344447 28 8.3 02_02_0263 - 8400488-8400913,8401011-8401481,8401581-8401843,840... 28 8.3 01_07_0081 - 40959279-40959375,40959463-40959589,40960138-409603... 28 8.3 >07_03_1731 - 29102403-29102720,29103529-29103735,29103937-29105210, 29105298-29105734,29106370-29106764,29106921-29107051, 29109034-29109052 Length = 926 Score = 33.1 bits (72), Expect = 0.22 Identities = 21/71 (29%), Positives = 37/71 (52%), Gaps = 1/71 (1%) Frame = -3 Query: 385 TSEFIDRTDKIISDATELQAMQNFIMEKIYDMN-NENKKQSEVDRYSSTLC*NSKTIW*R 209 TSE ++ DK++ A E++A EK Y++N ++NK+ S D + C Sbjct: 326 TSEDVETDDKLLQRAKEVEAKFMVSSEKKYELNMSKNKRLSANDMFQMIQCLTEDRKQLA 385 Query: 208 RTASSRLEAQL 176 SS+++A+L Sbjct: 386 YELSSQIKARL 396 >10_08_0172 - 15406961-15407488,15408068-15408187,15408308-15408568, 15408684-15409112 Length = 445 Score = 30.7 bits (66), Expect = 1.2 Identities = 19/56 (33%), Positives = 33/56 (58%), Gaps = 3/56 (5%) Frame = +1 Query: 478 VALWRRQRRGCAGHRDDALVLNALGVVE---LLAVDTFLALRDERVDRLVAVHAFV 636 VA+ + R+G GH++ +N LGVV+ L+ + + A DER +L+ V+ F+ Sbjct: 132 VAIKQLGRKGLQGHKEWVTEVNVLGVVDHPNLVKLIGYCAEDDERGMQLLLVYEFM 187 >07_03_0879 - 22256033-22256173,22256417-22256492,22256830-22257212, 22257924-22257983,22258073-22258303,22258475-22258562, 22259265-22259365,22259586-22259727,22259824-22259939 Length = 445 Score = 30.3 bits (65), Expect = 1.6 Identities = 26/73 (35%), Positives = 33/73 (45%), Gaps = 5/73 (6%) Frame = -3 Query: 685 PHRRTPVSQRHAFRERRQMRVLPPSDRR--VRHAGP---EMYRLQGALPHQVHSEQGRHH 521 PHR V+ R RR++ +LPPS RR VR A E+ G SE+ HH Sbjct: 10 PHRLLLVAGGR--RRRRRLLLLPPSPRRVCVRAAASVELEVAAAAGEYGLPFPSERAAHH 67 Query: 520 DALHSPVAVASRA 482 L + A RA Sbjct: 68 RELAAAAAAVERA 80 >03_01_0389 + 3021849-3022136,3022237-3022753,3022835-3022988, 3023076-3023166,3024556-3024627,3026366-3026689 Length = 481 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = -3 Query: 544 HSEQGRHHDALHSPVAVASRARPKNRKRIMPTTNHNPP 431 H ++G H + +P+AV + A P + P T PP Sbjct: 223 HQQRGHHPSYIRAPLAVVTAAPPPPPPFVNPATPQTPP 260 >02_04_0657 + 24786717-24786924,24786925-24786965,24787379-24787521, 24787597-24787774,24788054-24788123,24788197-24788345, 24788491-24788586,24789213-24789283,24789879-24789940, 24790175-24790238,24790326-24790410,24790515-24790641, 24790714-24790775,24790863-24790923,24790987-24791147, 24791355-24791648 Length = 623 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/43 (32%), Positives = 26/43 (60%) Frame = +1 Query: 91 MVMDSVDPSLAQTVSITWRKFPIKSLYLRAEPRVSTMLYVATR 219 MV+D + PSL + RKF +K++ + A+ ++ + Y+ TR Sbjct: 231 MVIDLLGPSLEDLFNYCNRKFSLKTVLMLADQMINRVEYMHTR 273 >05_03_0250 + 10955281-10955419,10955524-10955727,10955985-10956065, 10956147-10956287,10956378-10956410,10956809-10956909, 10957282-10957912,10959378-10959514 Length = 488 Score = 29.9 bits (64), Expect = 2.1 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +3 Query: 63 HEPSECVDPHGDGQRGPFPGADR 131 H P+ P GD R PFPG R Sbjct: 177 HNPTSAAQPGGDDHRQPFPGRHR 199 >10_08_0439 - 17926021-17927133 Length = 370 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -1 Query: 645 AKGDKCVYCHQAIDAFVTQGQKCIDCKELYHTKCI 541 A G +C C + D +G K + CK +YH CI Sbjct: 231 ADGAECAVCKE--DFSPGEGAKQMPCKHIYHADCI 263 >12_02_0030 + 12469707-12469902,12470337-12470658,12472208-12472245, 12472486-12473573 Length = 547 Score = 29.1 bits (62), Expect = 3.6 Identities = 33/127 (25%), Positives = 50/127 (39%), Gaps = 10/127 (7%) Frame = -3 Query: 673 TPVSQRHAFRERRQMRVLPPSDRRVRHAGPEMY-------RLQGALPHQVHSEQGRHHDA 515 TP + ++ R PP + HAG EM+ RL+G+ PH S G A Sbjct: 195 TPDTAHNSLSNDRSATPEPPVGSGLNHAGSEMFQPTERKGRLKGSAPHDTLSNAGTAASA 254 Query: 514 -LHSPVAVASRARP-KNRKRIMPTTN-HNPPADQKNSVTSNFNLTGTSEFIDRTDKIISD 344 + + V V +A ++ I T + P D N++ S L + K IS Sbjct: 255 GMGTSVLVPVKATQFESGSAITHTKDIPRPAGDISNAIISTGTLIPQKVSQVKLVKDISQ 314 Query: 343 ATELQAM 323 T Q + Sbjct: 315 QTNTQKL 321 >03_06_0199 + 32310272-32311432 Length = 386 Score = 29.1 bits (62), Expect = 3.6 Identities = 22/67 (32%), Positives = 29/67 (43%), Gaps = 2/67 (2%) Frame = -3 Query: 646 RERRQMRVLPPSDRRVRHAGPEMYRLQGALPHQVHSE-QGRHHDALHSPVAVASRAR-PK 473 R R + P D + A P +GA P VH + R HDAL A+ R R P Sbjct: 66 RRYRLVASAPGGDLVLAEASPPA---RGARPQPVHRRREARRHDALRGAAALRGRVRCPC 122 Query: 472 NRKRIMP 452 +R+ P Sbjct: 123 HRRFAHP 129 >10_08_0936 - 21679002-21679800,21679893-21680116,21681174-21681361, 21681505-21682597 Length = 767 Score = 28.7 bits (61), Expect = 4.8 Identities = 23/84 (27%), Positives = 39/84 (46%) Frame = -3 Query: 508 SPVAVASRARPKNRKRIMPTTNHNPPADQKNSVTSNFNLTGTSEFIDRTDKIISDATELQ 329 S +VAS AR RK ++ T + + D +N + SEF DR + +A L+ Sbjct: 145 SDSSVASPARSSFRKPVVGTPSSSSAWDWENFYPPS---PPDSEFFDRRKADLEEANRLR 201 Query: 328 AMQNFIMEKIYDMNNENKKQSEVD 257 ++ + Y + K++ EVD Sbjct: 202 ELEEEEKARGYLHPHHLKEEDEVD 225 >09_06_0322 - 22329897-22330078,22330569-22331928 Length = 513 Score = 28.7 bits (61), Expect = 4.8 Identities = 32/141 (22%), Positives = 55/141 (39%), Gaps = 17/141 (12%) Frame = -3 Query: 622 LPPSDRRVRHAGP--EMYRLQGALPHQVHSEQGRHHDALHSPVAVASRARPKNRKRIMPT 449 +PPS R+ H GP + A+ H + + H AL ++S ++ Sbjct: 134 IPPSLTRITHPGPMITFTNHEVAILHYIPEDTHHHPYALRPHNPLSSSSKQHYIVTAFSV 193 Query: 448 TNHNPPADQK---------NSVTSNFNLTGT----SEFIDRTDKIISDATELQAMQNFI- 311 + PP + K T++FNL T S F RT +I+ + + F+ Sbjct: 194 NRYRPPGEYKLHLYHSHTQQWTTTHFNLAATMPDLSPFHHRTTNVINLTHQSPGLMAFVD 253 Query: 310 -MEKIYDMNNENKKQSEVDRY 251 + + +N +K Q RY Sbjct: 254 LWQGLLLINVLDKVQPAAPRY 274 >06_03_0896 + 25753377-25754325,25755081-25755691 Length = 519 Score = 28.7 bits (61), Expect = 4.8 Identities = 23/65 (35%), Positives = 29/65 (44%), Gaps = 6/65 (9%) Frame = -3 Query: 658 RHAFRERRQMRVLPPSDRRVRHAGPEMYRLQGALPHQVHSEQGRHHDAL------HSPVA 497 R + R R LPPS + G ++ L GALPH+ + R H L PV Sbjct: 25 RSSRRRRGACGRLPPSPWALPVIG-HLHHLAGALPHRAMRDIARRHGPLVLLRLGELPVV 83 Query: 496 VASRA 482 VAS A Sbjct: 84 VASSA 88 >09_04_0435 - 17545879-17546605,17546721-17546782,17547123-17547335, 17547506-17547590,17547904-17548061,17548174-17548294, 17548765-17548927,17548973-17549097,17550800-17550888, 17550970-17551636,17552671-17552717,17553506-17553862 Length = 937 Score = 28.3 bits (60), Expect = 6.3 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -3 Query: 544 HSEQGRHHDALHSPVAVASRARPKNRKRIMPTTNHNP 434 +S QG+HHD+ S +S + ++R + +H P Sbjct: 879 YSNQGKHHDSSRSSNISSSNRKLTEQRRTIGEVDHGP 915 >02_05_0398 - 28644632-28644889,28644997-28645032,28645101-28645364, 28645439-28645522,28645718-28645798,28645888-28645965, 28646571-28646672,28646754-28646849,28646955-28647161, 28647246-28647493,28647577-28647773,28647997-28648112 Length = 588 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/60 (23%), Positives = 27/60 (45%) Frame = -3 Query: 424 QKNSVTSNFNLTGTSEFIDRTDKIISDATELQAMQNFIMEKIYDMNNENKKQSEVDRYSS 245 ++N T + L GT R ++ D TEL+ + ++Y + + + +D Y S Sbjct: 260 ERNKATRSLQLNGTHTTGSRGFAVVLDQTELKENRKVGRAELYVITHTKRNGEPLDEYCS 319 >01_07_0384 + 43209423-43210241 Length = 272 Score = 28.3 bits (60), Expect = 6.3 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 4/45 (8%) Frame = -1 Query: 627 VYCHQAIDAFV---TQGQKCIDC-KELYHTKCIQNKGVITMPCTA 505 VYC + + A + T+G+KCIDC Y + I G P A Sbjct: 127 VYCRRCVGAGMGDMTEGRKCIDCLGRRYSHRYIHRAGTNLTPSAA 171 >12_01_0421 - 3321590-3323692 Length = 700 Score = 27.9 bits (59), Expect = 8.3 Identities = 19/57 (33%), Positives = 24/57 (42%), Gaps = 2/57 (3%) Frame = -1 Query: 228 QRQSGSDVQHRRDSRLSS*VQRFDRELPPRDG--DGLRQGRVHAVHHHGGQRIQRVH 64 +R S S H + SS Q R+ PRD L G HHH G+R+ H Sbjct: 5 RRDSDSRSSHHAPHKSSSFSQPSARDDKPRDAIDRNLSLGSAGHHHHHDGRRLDLHH 61 >12_01_0014 + 105422-105520,105598-105725,105939-106101,106198-106310, 106787-106825,107026-107109,107193-107241,107331-107422, 107680-107809,107906-107982,108058-109676,110024-110221, 110287-110825 Length = 1109 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = +2 Query: 587 PCVTNASIAWWQYTHLSPFAKRVPLRNRCPAMR 685 PC I W + H+ A++ RCPA R Sbjct: 27 PCKCGYEICVWCWHHIIDMAEKEDTEGRCPACR 59 >11_06_0490 - 24293218-24293373,24293454-24293521,24293845-24293986, 24294079-24294699,24294791-24294871,24295002-24295072, 24296106-24296176,24296568-24296675,24296786-24297024, 24297493-24297657 Length = 573 Score = 27.9 bits (59), Expect = 8.3 Identities = 28/121 (23%), Positives = 40/121 (33%), Gaps = 3/121 (2%) Frame = -3 Query: 700 RERTLPHRRTPVSQRHAFRERRQMRVLPPS---DRRVRHAGPEMYRLQGALPHQVHSEQG 530 + T PH R RER + + DRR R G + H+ SE+ Sbjct: 55 QHETQPHDGRSSKSRERERERDKDKERDRDRDRDRRDRDRGDKDRDRDRHREHRDRSERR 114 Query: 529 RHHDALHSPVAVASRARPKNRKRIMPTTNHNPPADQKNSVTSNFNLTGTSEFIDRTDKII 350 HHD S R R+R H + S + + S R+ K + Sbjct: 115 EHHDRERSDDRDRRRGHDSERRRDRDRDGHRRHRSRSRSPSKGRDRRSRSRSRSRSSKRV 174 Query: 349 S 347 S Sbjct: 175 S 175 >11_01_0014 + 108647-108816,109704-109803,109891-110018,110232-110394, 110491-110603,111080-111118,111319-111402,111486-111534, 111624-111715,111999-112128,112225-112301,112377-113995, 114348-114545,114635-115173 Length = 1166 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = +2 Query: 587 PCVTNASIAWWQYTHLSPFAKRVPLRNRCPAMR 685 PC I W + H+ A++ RCPA R Sbjct: 84 PCKCGYEICVWCWHHIIDMAEKEDTEGRCPACR 116 >08_02_0204 - 14253258-14253383,14253685-14253878,14254029-14254743, 14254811-14254837,14258779-14258838,14263174-14264844, 14267402-14267518,14267593-14267763,14270248-14270346, 14271684-14271770,14272392-14272475,14272929-14273068, 14274414-14274494,14275492-14275680,14275986-14276022 Length = 1265 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = -3 Query: 559 LPHQVHSEQGRHHDALHSPVAVASRARPKNRKRIMPTTNHNPP 431 +P Q+ +E H A H P+ + +R + MPT +PP Sbjct: 1105 MPMQLPTETVNHFHAPHYPMQMPIENMALSRTQAMPTQMQSPP 1147 >06_03_0893 - 25721576-25722205,25722366-25722443,25722628-25723560 Length = 546 Score = 27.9 bits (59), Expect = 8.3 Identities = 22/61 (36%), Positives = 27/61 (44%), Gaps = 6/61 (9%) Frame = -3 Query: 646 RERRQMRVLPPSDRRVRHAGPEMYRLQGALPHQVHSEQGRHHDAL------HSPVAVASR 485 R R + LPPS + G ++ L GALPH + R H L PV VAS Sbjct: 31 RRRGEGGRLPPSPWGLPVIG-HLHHLAGALPHHAMRDLARRHGPLMLLRLGELPVVVASS 89 Query: 484 A 482 A Sbjct: 90 A 90 >06_03_0347 + 19783824-19784348 Length = 174 Score = 27.9 bits (59), Expect = 8.3 Identities = 18/71 (25%), Positives = 26/71 (36%), Gaps = 2/71 (2%) Frame = -1 Query: 684 RIAGHRFRKGTRFAKGDKCVYCHQAIDAFVTQGQKCIDCKELYHTKCIQN--KGVITMPC 511 +I + R G +C C A+ ++ CK LYH +CI T P Sbjct: 84 KIPEFAYAGSARHGGGGECSVCLGAVQGGEAV-RRLPACKHLYHVECIDMWLASHATCPI 142 Query: 510 TAPSLSPPERD 478 + PP D Sbjct: 143 CRTEVEPPPED 153 >02_05_0868 + 32342967-32343915,32344389-32344447 Length = 335 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = -1 Query: 657 GTRFAKGDKCVYCHQAIDAFVTQGQKCIDCKELYHTKCI 541 G + G +C C + D + + + + CK +YH+ CI Sbjct: 190 GAHLSDGSQCPVCKE--DFELGEAARQMPCKHVYHSDCI 226 >02_02_0263 - 8400488-8400913,8401011-8401481,8401581-8401843, 8401964-8402225 Length = 473 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 73 LNALTPMVMDSVDPSLAQTVSITWRKFPIKSLYLRAEPRVS 195 LN P DS DP + S+ +KFPI ++ + RV+ Sbjct: 289 LNIENPSRADSYDPRAGRITSLDSQKFPILNIIQMSATRVN 329 >01_07_0081 - 40959279-40959375,40959463-40959589,40960138-40960339, 40962414-40963361 Length = 457 Score = 27.9 bits (59), Expect = 8.3 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = -3 Query: 622 LPPSDRRVRHAGPEMYRLQGALPHQVHSEQGRHHDALH 509 LP D V H P + ++G LP HSE LH Sbjct: 365 LPAPDPDVPHISPSLSFIKGVLPKYFHSEWSVAQFRLH 402 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,030,029 Number of Sequences: 37544 Number of extensions: 399439 Number of successful extensions: 1684 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 1611 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1684 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1815633512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -