BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1451 (726 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 28 0.078 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 21 9.0 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 28.3 bits (60), Expect = 0.078 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -2 Query: 284 FYSVSNYIWLSVTNWTDNAISIFTEEHITFT 192 FY V Y+ L++ W D I +F E + T Sbjct: 49 FYEVFRYLELAMIRWKDTEIGLFLHEELRRT 79 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -3 Query: 637 SIRPTGVSSRXTSPDTSLRLGLS*RHV 557 S+ PT +S T P T+ +S +H+ Sbjct: 377 SLVPTTTASPTTEPSTTTSTTISQKHI 403 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 203,980 Number of Sequences: 438 Number of extensions: 4240 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -