BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1447 (736 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF063023-1|AAD20441.1| 1666|Caenorhabditis elegans AF-6 protein. 28 6.0 AF003135-4|AAO38590.1| 1039|Caenorhabditis elegans Hypothetical ... 28 6.0 AF003135-3|AAO38589.1| 1184|Caenorhabditis elegans Hypothetical ... 28 6.0 AF003135-2|AAO38588.1| 1419|Caenorhabditis elegans Hypothetical ... 28 6.0 AF003135-1|AAK18989.1| 1658|Caenorhabditis elegans Hypothetical ... 28 6.0 >AF063023-1|AAD20441.1| 1666|Caenorhabditis elegans AF-6 protein. Length = 1666 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +2 Query: 551 FVWNGIVCLRLPLGALFQLHTKLGQPLRYR 640 FV+N +V + LP QL+T+LG+ L+YR Sbjct: 734 FVFNSLVSVNLPAA---QLNTRLGKCLQYR 760 >AF003135-4|AAO38590.1| 1039|Caenorhabditis elegans Hypothetical protein W03F11.6e protein. Length = 1039 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +2 Query: 551 FVWNGIVCLRLPLGALFQLHTKLGQPLRYR 640 FV+N +V + LP QL+T+LG+ L+YR Sbjct: 732 FVFNSLVSVNLPAA---QLNTRLGKCLQYR 758 >AF003135-3|AAO38589.1| 1184|Caenorhabditis elegans Hypothetical protein W03F11.6d protein. Length = 1184 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +2 Query: 551 FVWNGIVCLRLPLGALFQLHTKLGQPLRYR 640 FV+N +V + LP QL+T+LG+ L+YR Sbjct: 732 FVFNSLVSVNLPAA---QLNTRLGKCLQYR 758 >AF003135-2|AAO38588.1| 1419|Caenorhabditis elegans Hypothetical protein W03F11.6c protein. Length = 1419 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +2 Query: 551 FVWNGIVCLRLPLGALFQLHTKLGQPLRYR 640 FV+N +V + LP QL+T+LG+ L+YR Sbjct: 732 FVFNSLVSVNLPAA---QLNTRLGKCLQYR 758 >AF003135-1|AAK18989.1| 1658|Caenorhabditis elegans Hypothetical protein W03F11.6a protein. Length = 1658 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/30 (46%), Positives = 21/30 (70%) Frame = +2 Query: 551 FVWNGIVCLRLPLGALFQLHTKLGQPLRYR 640 FV+N +V + LP QL+T+LG+ L+YR Sbjct: 732 FVFNSLVSVNLPAA---QLNTRLGKCLQYR 758 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,392,587 Number of Sequences: 27780 Number of extensions: 311738 Number of successful extensions: 625 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 625 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1724918872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -