BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1446 (752 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 27 0.16 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 27 0.16 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 25 0.49 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 24 1.1 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 24 1.1 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 24 1.1 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 24 1.1 U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 23 2.0 AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 23 2.0 AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 23 2.0 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 23 2.6 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 27.1 bits (57), Expect = 0.16 Identities = 13/45 (28%), Positives = 31/45 (68%), Gaps = 3/45 (6%) Frame = -3 Query: 198 HYLHTH--TFFR*WNKILDKYLFKLENNYRAMTV-TENIRYKLIF 73 HYL+ + TF WN+++++YL +E++ + ++ +++R K++F Sbjct: 1186 HYLNRNEETF---WNELIEQYLHPIEDDKKKVSAELKDLRDKMVF 1227 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 27.1 bits (57), Expect = 0.16 Identities = 13/45 (28%), Positives = 31/45 (68%), Gaps = 3/45 (6%) Frame = -3 Query: 198 HYLHTH--TFFR*WNKILDKYLFKLENNYRAMTV-TENIRYKLIF 73 HYL+ + TF WN+++++YL +E++ + ++ +++R K++F Sbjct: 1186 HYLNRNEETF---WNELIEQYLHPIEDDKKKVSAELKDLRDKMVF 1227 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 25.4 bits (53), Expect = 0.49 Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = -3 Query: 495 SFYLIKK*ERSRTLEFIVSDAEI-NQFVL 412 SFY+ K R R+L+F+ S+ I +FVL Sbjct: 182 SFYISDKAARPRSLQFVDSEGNILEEFVL 210 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 24.2 bits (50), Expect = 1.1 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 165 WNKILDKYLFKLENN 121 W +LDKYL+ ++ N Sbjct: 1236 WKDLLDKYLYPIDEN 1250 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 24.2 bits (50), Expect = 1.1 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 165 WNKILDKYLFKLENN 121 W +LDKYL+ ++ N Sbjct: 1236 WKDLLDKYLYPIDEN 1250 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 24.2 bits (50), Expect = 1.1 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 165 WNKILDKYLFKLENN 121 W +LDKYL+ ++ N Sbjct: 1236 WKDLLDKYLYPIDEN 1250 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 24.2 bits (50), Expect = 1.1 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 165 WNKILDKYLFKLENN 121 W +LDKYL+ ++ N Sbjct: 1236 WKDLLDKYLYPIDEN 1250 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 23.4 bits (48), Expect = 2.0 Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 2/58 (3%) Frame = +1 Query: 376 YSHGNYLFHYIAENKLVYFCITDDKFQRSRAFL--FLNEIKRRFTTDLLTPHRQQYLT 543 Y+H N ++H + E + C +F ++ +L F N + D T H QY T Sbjct: 39 YTHNNEMYHRVKEEPIYESC----RFSINQPYLNHFDNSVTPMVNHD-FTQHLSQYDT 91 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 23.4 bits (48), Expect = 2.0 Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 2/58 (3%) Frame = +1 Query: 376 YSHGNYLFHYIAENKLVYFCITDDKFQRSRAFL--FLNEIKRRFTTDLLTPHRQQYLT 543 Y+H N ++H + E + C +F ++ +L F N + D T H QY T Sbjct: 39 YTHNNEMYHRVKEEPIYESC----RFSINQPYLNHFDNSVTPMVNHD-FTQHLSQYDT 91 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 23.4 bits (48), Expect = 2.0 Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 2/58 (3%) Frame = +1 Query: 376 YSHGNYLFHYIAENKLVYFCITDDKFQRSRAFL--FLNEIKRRFTTDLLTPHRQQYLT 543 Y+H N ++H + E + C +F ++ +L F N + D T H QY T Sbjct: 39 YTHNNEMYHSVKEEPIYESC----RFSINQPYLNHFDNSVTPMVNHD-FTQHLSQYDT 91 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 23.0 bits (47), Expect = 2.6 Identities = 11/41 (26%), Positives = 24/41 (58%) Frame = +2 Query: 203 GNIVFFVSFTRLFTMPIYSVSWLEAL*SSLNMQLVRVISLK 325 G IVF + F + T PI+++ ++ ++ N+ L +V + + Sbjct: 138 GLIVFILFFAQGLTSPIFNLVYVYCCDNNFNVFLRQVFTCR 178 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,223 Number of Sequences: 336 Number of extensions: 3961 Number of successful extensions: 15 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20131186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -