BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1442 (763 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value D21852-1|BAA04878.2| 974|Homo sapiens KIAA0029 protein. 32 1.9 BC041093-1|AAH41093.1| 1099|Homo sapiens R3H domain containing 1... 32 1.9 AC016742-1|AAY14728.1| 784|Homo sapiens unknown protein. 32 1.9 >D21852-1|BAA04878.2| 974|Homo sapiens KIAA0029 protein. Length = 974 Score = 32.3 bits (70), Expect = 1.9 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +1 Query: 289 STSYVSSIPLISQPIAYSAHFIKKRSPQWPVSYIAPSSY 405 + Y +S +SQP+ +I++ SPQ P Y AP Y Sbjct: 489 TAGYPASGHPVSQPVLQQQGYIQQPSPQMPACYCAPGHY 527 >BC041093-1|AAH41093.1| 1099|Homo sapiens R3H domain containing 1 protein. Length = 1099 Score = 32.3 bits (70), Expect = 1.9 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +1 Query: 289 STSYVSSIPLISQPIAYSAHFIKKRSPQWPVSYIAPSSY 405 + Y +S +SQP+ +I++ SPQ P Y AP Y Sbjct: 614 TAGYPASGHPVSQPVLQQQGYIQQPSPQMPACYCAPGHY 652 >AC016742-1|AAY14728.1| 784|Homo sapiens unknown protein. Length = 784 Score = 32.3 bits (70), Expect = 1.9 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +1 Query: 289 STSYVSSIPLISQPIAYSAHFIKKRSPQWPVSYIAPSSY 405 + Y +S +SQP+ +I++ SPQ P Y AP Y Sbjct: 614 TAGYPASGHPVSQPVLQQQGYIQQPSPQMPACYCAPGHY 652 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,451,004 Number of Sequences: 237096 Number of extensions: 2142272 Number of successful extensions: 9548 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9179 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9541 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9144232952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -