BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1436 (703 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9XXW0 Cluster: Endonuclease and reverse transcriptase-... 56 6e-07 UniRef50_Q8ITJ9 Cluster: Transposase; n=7; Arthropoda|Rep: Trans... 37 0.42 UniRef50_Q28RA2 Cluster: ComEC/Rec2-related protein; n=2; Rhodob... 36 0.73 UniRef50_Q3UY09 Cluster: Adult male olfactory brain cDNA, RIKEN ... 33 6.8 >UniRef50_Q9XXW0 Cluster: Endonuclease and reverse transcriptase-like protein; n=9; cellular organisms|Rep: Endonuclease and reverse transcriptase-like protein - Bombyx mori (Silk moth) Length = 960 Score = 56.4 bits (130), Expect = 6e-07 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = -2 Query: 399 RRPRHVLTDPSDPITFALDAFSSNTRS 319 RRPRHVLTDPSDPIT ALD FSSNTRS Sbjct: 914 RRPRHVLTDPSDPITLALDTFSSNTRS 940 >UniRef50_Q8ITJ9 Cluster: Transposase; n=7; Arthropoda|Rep: Transposase - Bombyx mori (Silk moth) Length = 346 Score = 37.1 bits (82), Expect = 0.42 Identities = 18/43 (41%), Positives = 28/43 (65%) Frame = +3 Query: 396 AARTTKAANAVKARIGRSPDKKQKILSREMKISARTLSVL*NK 524 + RT AVKARI R+P +KQK+L+ +M +S T+ + N+ Sbjct: 63 SVRTPAVIKAVKARIQRNPKRKQKLLALQMGLSRTTVKRVLNE 105 >UniRef50_Q28RA2 Cluster: ComEC/Rec2-related protein; n=2; Rhodobacteraceae|Rep: ComEC/Rec2-related protein - Jannaschia sp. (strain CCS1) Length = 706 Score = 36.3 bits (80), Expect = 0.73 Identities = 18/39 (46%), Positives = 22/39 (56%) Frame = +3 Query: 51 PEGLSSFTRTGGRAKAQPRGAGFANNCPSTSEGDLTTQE 167 P GL T GRA ++PRG GF ++GDL TQE Sbjct: 540 PGGLVGLTTDQGRALSRPRGDGFVAGIWLENDGDLITQE 578 >UniRef50_Q3UY09 Cluster: Adult male olfactory brain cDNA, RIKEN full-length enriched library, clone:6430562O12 product:hypothetical protein, full insert sequence; n=1; Mus musculus|Rep: Adult male olfactory brain cDNA, RIKEN full-length enriched library, clone:6430562O12 product:hypothetical protein, full insert sequence - Mus musculus (Mouse) Length = 133 Score = 33.1 bits (72), Expect = 6.8 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = -3 Query: 89 SPTCPGETGKAFGPPVNYQS*KKKKKNG 6 S PG G+A PP+ YQ KKKKK G Sbjct: 65 SQQVPGWIGEATSPPICYQKKKKKKKRG 92 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 598,418,008 Number of Sequences: 1657284 Number of extensions: 10846550 Number of successful extensions: 22852 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 22343 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22849 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 55785129165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -