BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1436 (703 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ494421-1|ABF55372.1| 73|Tribolium castaneum telomerase rever... 24 1.0 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 24 1.0 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 23 1.8 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 1.8 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 21 9.7 >DQ494421-1|ABF55372.1| 73|Tribolium castaneum telomerase reverse transcriptase protein. Length = 73 Score = 24.2 bits (50), Expect = 1.0 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 502 LCPCYKTRPEARCLSLIYRTCPKSIF 579 LC +KT+ + L+L+ PKS F Sbjct: 36 LCKKHKTKKPVQILALLQEIIPKSYF 61 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 24.2 bits (50), Expect = 1.0 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 502 LCPCYKTRPEARCLSLIYRTCPKSIF 579 LC +KT+ + L+L+ PKS F Sbjct: 36 LCKKHKTKKPVQILALLQEIIPKSYF 61 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 23.4 bits (48), Expect = 1.8 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -3 Query: 143 GGARAVVSKSRPSWLSLCSPTCPGETGKAFGPPV 42 GG R+ + S + + C PG++G+ FGP + Sbjct: 29 GGKRSKFAISENA-VKPCVSCGPGQSGQCFGPSI 61 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 23.4 bits (48), Expect = 1.8 Identities = 7/29 (24%), Positives = 19/29 (65%) Frame = -3 Query: 326 LGAGLGTPVTVLVELDKEFDVQPNHESAR 240 +G+GL + + V+ +FD++ ++++R Sbjct: 781 IGSGLSAVIQISVQAPPQFDIKLRNQTSR 809 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 21.0 bits (42), Expect = 9.7 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +1 Query: 349 CKGYWI*RIRKDVSRA 396 CKG++ +RKD+S A Sbjct: 106 CKGFFKRTVRKDLSYA 121 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,522 Number of Sequences: 336 Number of extensions: 2509 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18530690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -