BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1434 (332 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g19920.1 68415.m06036 RNA-dependent RNA polymerase family pro... 27 2.4 At4g16360.1 68417.m02478 5'-AMP-activated protein kinase beta-2 ... 27 4.1 >At2g19920.1 68415.m06036 RNA-dependent RNA polymerase family protein contains Pfam domain, PF05183: RNA dependent RNA polymerase Length = 927 Score = 27.5 bits (58), Expect = 2.4 Identities = 16/52 (30%), Positives = 22/52 (42%), Gaps = 3/52 (5%) Frame = +2 Query: 131 LPISTYTKIYW---GNNYKSPPTAGLDGRASLYQCNGEPAGRHHLLLNFLLN 277 LP+ Y + W G N + G+ YQC+ P G + L FL N Sbjct: 184 LPMVAYERAVWFKLGQNEERMQLESDSGKTHYYQCHVAPDGSYRLKGYFLEN 235 >At4g16360.1 68417.m02478 5'-AMP-activated protein kinase beta-2 subunit, putative similar to Swiss-Prot:Q9QZH4 5'-AMP-activated protein kinase, beta-2 subunit (AMPK beta-2 chain) [Rattus norvegicus] Length = 259 Score = 26.6 bits (56), Expect = 4.1 Identities = 17/56 (30%), Positives = 24/56 (42%) Frame = +1 Query: 55 PGGKWLPXPMDXXNARSKAKPLPTMPTNINLHKNILG**LQKSPDRWSGRSRVTLS 222 P W+ P S + +PTM T + K I ++ S D W RSR+ S Sbjct: 51 PNPSWMQSPSSLYEEASNEQGIPTMITWCHGGKEIA---VEGSWDNWKTRSRLQRS 103 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,434,411 Number of Sequences: 28952 Number of extensions: 118357 Number of successful extensions: 262 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 260 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 262 length of database: 12,070,560 effective HSP length: 71 effective length of database: 10,014,968 effective search space used: 390583752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -