BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1428 (539 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC4B4.09 |usp105|prp39|U1 snRNP-associated protein Usp105|Schi... 29 0.58 SPBC12C2.05c |||diacylglycerol binding protein Bzz1 |Schizosacch... 29 0.58 SPBC776.14 |plh1||phospholipid-diacylglycerol acyltransferase Pl... 29 0.58 SPCC1322.05c |||leukotriene A-4 hydrolase |Schizosaccharomyces p... 27 1.8 SPAC1834.09 |mug51||conserved fungal protein|Schizosaccharomyces... 26 3.1 SPBC25H2.13c |cdc20|pol2|DNA polymerase epsilon catalytic subuni... 25 5.4 SPBC119.17 ||SPBC577.01|metallopeptidase|Schizosaccharomyces pom... 25 5.4 >SPBC4B4.09 |usp105|prp39|U1 snRNP-associated protein Usp105|Schizosaccharomyces pombe|chr 2|||Manual Length = 612 Score = 28.7 bits (61), Expect = 0.58 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +1 Query: 169 VKFRVQILLNKKNYTEHYNMLDNI 240 ++F ++ LN KNYTEH+ + N+ Sbjct: 470 LRFELEQPLNSKNYTEHHARVSNV 493 >SPBC12C2.05c |||diacylglycerol binding protein Bzz1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 642 Score = 28.7 bits (61), Expect = 0.58 Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = -2 Query: 334 QENDKKFIKKTF--IKYENSYHKSKKNRFIFTMLYYQAYCNVRYN 206 Q+NDK +KT +K S KKN+++ ML Y A+ YN Sbjct: 170 QKNDKYREQKTQRNLKLSESDMLDKKNKYLLRMLVYNAHKQKFYN 214 >SPBC776.14 |plh1||phospholipid-diacylglycerol acyltransferase Plh1|Schizosaccharomyces pombe|chr 2|||Manual Length = 623 Score = 28.7 bits (61), Expect = 0.58 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -2 Query: 337 LQENDKKFIK-KTFIKYENSYHKSK 266 L+E DK F K K FI+Y N HK K Sbjct: 262 LEERDKYFSKLKMFIEYSNIVHKKK 286 >SPCC1322.05c |||leukotriene A-4 hydrolase |Schizosaccharomyces pombe|chr 3|||Manual Length = 612 Score = 27.1 bits (57), Expect = 1.8 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -2 Query: 337 LQENDKKFIKKTFIKYENSYHK 272 L E D+ F +TF KY++ YHK Sbjct: 577 LNEADRAFAIETFEKYKHFYHK 598 >SPAC1834.09 |mug51||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 306 Score = 26.2 bits (55), Expect = 3.1 Identities = 9/25 (36%), Positives = 18/25 (72%), Gaps = 2/25 (8%) Frame = -2 Query: 526 FYVCLYSD--HLMSDVFQLHSMLLE 458 +Y+C + D H+ + +F+LH +L+E Sbjct: 155 YYLCKFKDQEHIYTLIFKLHKLLIE 179 >SPBC25H2.13c |cdc20|pol2|DNA polymerase epsilon catalytic subunit a Pol2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 2199 Score = 25.4 bits (53), Expect = 5.4 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = -2 Query: 331 ENDKKFIKKTFIKYENSYHKSKKNRFIFTM 242 +ND ++ + Y ++H S NRF+F++ Sbjct: 1443 DNDVSYLDGVEMNYLYAFHFSISNRFVFSL 1472 >SPBC119.17 ||SPBC577.01|metallopeptidase|Schizosaccharomyces pombe|chr 2|||Manual Length = 992 Score = 25.4 bits (53), Expect = 5.4 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -2 Query: 340 WLQENDKKFIKKTFIKYENSYHKSKKNRFIFTML 239 WL++ + K F K Y K+RF+FTML Sbjct: 458 WLKQKNSD--GKLFQKLIKKYILENKSRFVFTML 489 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,978,364 Number of Sequences: 5004 Number of extensions: 35350 Number of successful extensions: 75 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 75 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 221892220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -