BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--1422 (684 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37142| Best HMM Match : Peptidase_A22B (HMM E-Value=0) 29 4.6 SB_47519| Best HMM Match : rve (HMM E-Value=4.3e-09) 28 6.1 >SB_37142| Best HMM Match : Peptidase_A22B (HMM E-Value=0) Length = 1019 Score = 28.7 bits (61), Expect = 4.6 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 11/88 (12%) Frame = +1 Query: 382 LVLCVVLITIFLNF-YLDFIWTLCFSLNS---------RLIL-VTTNDSSIPFQNSRLAD 528 L++C +L+ +F + YL ++ + F+L S LIL + IP N L Sbjct: 81 LLICGLLLLLFYFYKYLVYVIIVLFALASCNGLFDCLMPLILWLPLGSCKIPANNLPLLK 140 Query: 529 KLYELRRLLHMTH*VKQSKWWTVRRNTS 612 K E+R ++ + S WW + RN S Sbjct: 141 KQPEVRLIVLALFCMGMSIWWGIERNAS 168 >SB_47519| Best HMM Match : rve (HMM E-Value=4.3e-09) Length = 321 Score = 28.3 bits (60), Expect = 6.1 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 3/61 (4%) Frame = +1 Query: 448 CFSLNSRLILVTTNDSSIPFQ---NSRLADKLYELRRLLHMTH*VKQSKWWTVRRNTSVS 618 C S NS + D S+ Q + LAD+ + R ++ H V++SKW ++RN Sbjct: 203 CASTNSAPGEFSERDMSLRRQWRHSQYLADQFWRQWRREYVPHLVQRSKWRAIQRNLRRG 262 Query: 619 D 621 D Sbjct: 263 D 263 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,619,908 Number of Sequences: 59808 Number of extensions: 334534 Number of successful extensions: 864 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 827 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 864 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -